SAXSdb — 7dn1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carbonyl Reductase

Candida parapsilosis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	(S)-specific carbonyl reductase × 2 （D5G304） NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2KJ46_CANPA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–280； UniProt 1–279

(S)-specific carbonyl reductase

Candida parapsilosis

UniProt D5G304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Carbonyl Reductase × 2 （B2KJ46） NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5G304_CANPA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–280； UniProt 1–279

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7dn1
Deposition date deposition_date	2020-12-08
Structure title title	Hetero-oligomers of SCR-SCR2 crystal structure with NADPH
Keywords keywords	Rossman fold, tetramer, tag-free, wild type with NADPH, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7dn1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7dn1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7dn1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.60 Å
Rg (electron density)	28.41 Å
Total Rg	29.22 Å
Atom count	8676
Residues	1120
Excluded volume	153620 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7dn1__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Carbonyl Reductase
Molecular weight formula_weight	30204.9 kDa
EC 编号 ec_number	1.1.1.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4581

SMGEIESYCNKELGPLPTKAPTLSKNVLDLFSLKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEETISQQEKDFGTIDVFVANAGVTWTQGPEIDVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISGKIVNIPQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYTCP

Source Source

Source organism organism	Candida parapsilosis
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	5480
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	(S)-specific carbonyl reductase
Molecular weight formula_weight	30108.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

SMGEIESYCNKELGPLPTKAPTLSKNVLDLFSLKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVRSKAYKCNISDPKSVEETISQQEKDFGTIDVFVANAGVPWTEGPEINVDNYDSWNKIINLDLNGVYYCAHTVGKIFKKNGKGSLVITSSMSGTIVNVPQLQAAYNAAKAACTHLTKSLAVEWAPFARVNCVSPGYIATEISDFVEKDMKAKWWQLTPLGREGLAQELVGAYLYLASNASTYTTGANLAVDGGYTCP

Source Source

Source organism organism	Candida parapsilosis
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	5480
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	745.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	243

▶

Unit-cell length a length_a	69.589 Å
Unit-cell length b length_b	114.676 Å
Unit-cell length c length_c	127.752 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	orthorhombic

Resolution resolution	1.740 Å
Low-resolution limit resolution_low	34.190 Å
R factor r_factor	0.1677
R_work r_work	0.1661
R_free r_free	0.2066

Hetero-oligomers of SCR-SCR2 crystal structure with NADPH

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carbonyl Reductase

State in the Current Structure

Other States of the Same Protein in the Database

(S)-specific carbonyl reductase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7dn1__assembly_1__model_1

7dn1__assembly_1__model_1 | I(q)

7dn1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Hetero-oligomers of SCR-SCR2 crystal structure with NADPH

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carbonyl Reductase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

(S)-specific carbonyl reductase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7dn1__assembly_1__model_1

7dn1__assembly_1__model_1 | I(q)

7dn1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)