SAXSdb — 7dpg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virion protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	VP2 × 60 （A0A2S0RQC2） VP3 × 60 （L7UV52）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	VP2 × 1 （A0A2S0RQC2） VP3 × 1 （L7UV52）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	VP2 × 5 （A0A2S0RQC2） VP3 × 5 （L7UV52）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 18	VP2 × 6 （A0A2S0RQC2） VP3 × 6 （L7UV52）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	VP2 × 1 （A0A2S0RQC2） VP3 × 1 （L7UV52）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W8GTF7_9ENTO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–278； UniProt 1–278

VP2

OrganismNot specified

UniProt A0A2S0RQC2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	Virion protein 1 × 60 （W8GTF7） VP3 × 60 （L7UV52）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Virion protein 1 × 1 （W8GTF7） VP3 × 1 （L7UV52）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	Virion protein 1 × 5 （W8GTF7） VP3 × 5 （L7UV52）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 18	Virion protein 1 × 6 （W8GTF7） VP3 × 6 （L7UV52）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Virion protein 1 × 1 （W8GTF7） VP3 × 1 （L7UV52）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2S0RQC2_9ENTO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–263； UniProt 70–332

VP3

OrganismNot specified

UniProt L7UV52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 180	Virion protein 1 × 60 （W8GTF7） VP2 × 60 （A0A2S0RQC2）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Virion protein 1 × 1 （W8GTF7） VP2 × 1 （A0A2S0RQC2）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 15	Virion protein 1 × 5 （W8GTF7） VP2 × 5 （A0A2S0RQC2）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 18	Virion protein 1 × 6 （W8GTF7） VP2 × 6 （A0A2S0RQC2）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Virion protein 1 × 1 （W8GTF7） VP2 × 1 （A0A2S0RQC2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L7UV52_9ENTO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–238； UniProt 333–570

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7dpg
Deposition date deposition_date	2020-12-18
Structure title title	Cryo-EM structure of Coxsackievirus B1 empty particle
Keywords keywords	Coxsackievirus B1, empty particle, Cryo-EM, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7dpg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7dpg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7dpg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	142.40 Å
Total Rg	142.40 Å
Atom count	320340
Residues	40920
Excluded volume	5695500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7dpg__assembly_1__model_1`	180-meric （180）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7dpg__assembly_2__model_1`	trimeric （3）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`7dpg__assembly_3__model_1`	pentadecameric （15）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`7dpg__assembly_4__model_1`	octadecameric （18）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`7dpg__assembly_5__model_1`	trimeric （3）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Virion protein 1
Molecular weight formula_weight	31207.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	5339

GPVEESVDRAVARVADTISSRPTNSESIPALTAAETGHTSQVVPSDTMQTRHVKNYHSRSESSIENFLCRSACVYYATYTNNSKKGFAEWVINTRQVAQLRRKLELFTYLRFDLELTFVITSAQQPSTASSVDAPVQTHQIMYVPPGGPVPTKVKDYAWQTSTNPSVFWTEGNAPPRMSIPFISIGNAYSCFYDGWTQFSRNGVYGINTLNNMGTLYMRHVNEAGQGPIKSTVRIYFKPKHVKAWVPRPPRLCQYEKQKNVNFSPIGVTTSRTDIITT

Entity 2 Entity 2 polymer

Description description	VP2
Molecular weight formula_weight	29122.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SPSAEECGYSDRVRSITLGNSTITTQECANVVVGYGVWPEYLKDNEATAEDQPTQPDVATCRFYTLESVQWMKNSAGWWWKLPDALSQMGLFGQNMQYHYLGRTGYTIHVQCNASKFHQGCLLVVCVPEAEMGCSNLNNTPEFSELSGGDSARMFTDTQVGESNAKKVQTAVWNAGMGVGVGNLTIFPHQWINLRTNNSATLVMPYINSVPMDNMFRHNNLTLMIIPFVPLNYSEGSSPYVPITVTIAPMCAEYNGLRLASNQ

Entity 3 Entity 3 polymer

Description description	VP3
Molecular weight formula_weight	26328.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GLPVMTTPGSTQFLTSDDFQSPSAMPQFDVTPEMQIPGRVNNLMEIAEVDSVVPVNNTEDNVSSLKAYQIPVQSNSDNGKQVFGFPLQPGANNVLNRTLLGEILNYYTHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGVPKNRKDAMLGTHVIWDVGLQSSCVLCVPWISQTHYRYVVEDEYTAAGYVTCWYQTNIVVPADVQSSCDILCFVSACNDFSVRMLKDTPFIRQDTFYQ

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	7dpg201
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	25320

Cryo-EM structure of Coxsackievirus B1 empty particle

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virion protein 1

State in the Current Structure

Other States of the Same Protein in the Database

VP2

State in the Current Structure

Other States of the Same Protein in the Database

VP3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7dpg__assembly_1__model_1

7dpg__assembly_1__model_1 | I(q)

7dpg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

Cryo-EM structure of Coxsackievirus B1 empty particle

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virion protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

VP2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

VP3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7dpg__assembly_1__model_1

7dpg__assembly_1__model_1 | I(q)

7dpg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)