7e8s

Intact TRAPPII (state I).

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRAPP-associated protein TCA17

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 65 × 2 （P32893）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCA17_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–152； UniProt 1–152 Author chain L； PDBConstruct 1–152； UniProt 1–152

Trafficking protein particle complex subunit 33

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q99394

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 65 × 2 （P32893）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS33_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–268； UniProt 1–268 Author chain M； PDBConstruct 1–268； UniProt 1–268

Trafficking protein particle complex subunit BET3

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P36149

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 65 × 2 （P32893）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BET3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–193； UniProt 1–193 Author chain F； PDBConstruct 1–193； UniProt 1–193 Author chain N； PDBConstruct 1–193； UniProt 1–193 Author chain Q； PDBConstruct 1–193； UniProt 1–193

Trafficking protein particle complex subunit BET5

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q03630

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 65 × 2 （P32893）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BET5_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–159； UniProt 1–159 Author chain O； PDBConstruct 1–159； UniProt 1–159

Trafficking protein particle complex subunit 23

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q03784

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 65 × 2 （P32893）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS23_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–219； UniProt 1–219 Author chain P； PDBConstruct 1–219； UniProt 1–219

Trafficking protein particle complex subunit 31

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q03337

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 65 × 2 （P32893）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS31_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–283； UniProt 1–283 Author chain R； PDBConstruct 1–283； UniProt 1–283

Trafficking protein particle complex subunit 20

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P38334

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 65 × 2 （P32893）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS20_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–175； UniProt 1–175 Author chain S； PDBConstruct 1–175； UniProt 1–175

Trafficking protein particle complex II-specific subunit 130

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q03660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 65 × 2 （P32893）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TR130_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–1102； UniProt 1–1102 Author chain T； PDBConstruct 1–1102； UniProt 1–1102

Trafficking protein particle complex II-specific subunit 120

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt Q04183

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 65 × 2 （P32893）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TR120_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–1289； UniProt 1–1289 Author chain U； PDBConstruct 1–1289； UniProt 1–1289

Trafficking protein particle complex II-specific subunit 65

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P32893

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS65_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–560； UniProt 1–560 Author chain V； PDBConstruct 1–560； UniProt 1–560

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7e8s
Deposition date deposition_date	2021-03-02
Structure title title	Intact TRAPPII (state I).
Keywords keywords	Complex, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7e8s__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7e8s__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7e8s__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	100.50 Å
Total Rg	99.92 Å
Atom count	46554
Residues	6572
Excluded volume	817330 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7e8s__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	TRAPP-associated protein TCA17
Molecular weight formula_weight	17371.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L
Atom count atom_count	46554

MSLRPCFVSLIDESDKPILIYVPNEAENEMNDVLKYNVLSNISLDYFESALVEWHSLDSKPLLKSIFQLEGVSVFAMLIKQTGLKIVIGFEQKSLSGADDEFEAINQIFETVRKIYIRVKCNPLLVSGDEKSIIKSLERKFDELFISTEVEL

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 polymer

Description description	Trafficking protein particle complex subunit 33
Molecular weight formula_weight	30786.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

MSSTHSNNVGHPQSSPQGPLTEQQRAQQQYQIFENSLPKVSQSVYQMLLNEMVPLAMGIERQISGDVISSDSNVTSENGNINNMIKRLKIEEHHTVDIIRSHNLIHELYKADEEEKEKVLARLRNIGFQIGLKLSELLIFSNNPNLKFKEMDLLLIMKFICRDVWKQIFGKQIDNLKTNHRGTFYLLDYDYRPIQSFSLEEDAKNEELKMIEPFLEIPVGIIRGVLSSLGYSSEEVICLASFIDRPTDRPKTAFPKGVSFHVQVTMPQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 3 Entity 3 polymer

Description description	Trafficking protein particle complex subunit BET3
Molecular weight formula_weight	22152.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,N,Q

MVSTTQSRSLKAMGEEIWKNKTEKINTELFTLTYGSIVAQLCQDYERDFNKVNDHLYSMGYNIGCRLIEDFLARTALPRCENLVKTSEVLSKCAFKIFLNITPNITNWSHNKDTFSLILDENPLADFVELPMDAMKSLWYSNILCGVLKGSLEMVQLDCDVWFVSDILRGDSQTEIKVKLNRILKDEIPIGED

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 4 Entity 4 polymer

Description description	Trafficking protein particle complex subunit BET5
Molecular weight formula_weight	18453.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

MGIYSFWIFDRHCNCIFDREWTLASNSASGTINSKQNEEDAKLLYGMIFSLRSITQKLSKGSVKNDIRSISTGKYRVHTYCTASGLWFVLLSDFKQQSYTQVLQYIYSHIYVKYVSNNLLSPYDFAENENEMRGQGTRKITNRNFISVLESFLAPMVNQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 5 Entity 5 polymer

Description description	Trafficking protein particle complex subunit 23
Molecular weight formula_weight	24889.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P

MAIETILVINKSGGLIYQRNFTNDEQKLNSNEYLILASTLHGVFAIASQLTPKALQLTQQTNIENTIPYIPYVGMSSNRSDTRNGGGNNNKHTNNEKLGSFKGDDFFKEPFTNWNKSGLRQLCTDQFTMFIYQTLTGLKFVAISSSVMPQRQPTIATTDKPDRPKSTSNLAIQIADNFLRKVYCLYSDYVMKDPSYSMEMPIRSNLFDEKVKKMVENLQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 6 Entity 6 polymer

Description description	Trafficking protein particle complex subunit 31
Molecular weight formula_weight	31743.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

MSQRIIQPSASDQQFPGKSDGYEYTVGPKQAITSEASTTYIPSRIYSESLLFKRQEASLSAMAFLFQEMISQLHRTCKTAGDFETKLSDYGHNIGIRLLELLNFRASSSPSSLPRASAFLSQNESSSKLSNASNSPGMLANSSTATSASANERLQEKQTESLSNYITKMRRRDLKILDILQFIHGTLWSYLFNHVSDDLVKSSERDNEYMIVDNFPTLTQFIPGENVSCEYFVCGIIKGFLFNAGFPCGVTAHRMPQGGHSQRTVYLIQFDRQVLDREGLRFG

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 7 Entity 7 polymer

Description description	Trafficking protein particle complex subunit 20
Molecular weight formula_weight	19721.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

MPQYFAIIGKKDNPVYEIEFTNAENPQGFPQDLKELNPFILHASLDIVEDLQWQINPTSQLNGNGGNGSNGGGGFLRSRAVNNTDNCYLGKVDHFYGLAITAYISYSGMKFVMIHGNSANSSVVIDDNNMRSFYQEVHELYVKTLMNPFYKITDPIRSPAFDSRVRTLARKHLSK

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 8 Entity 8 polymer

Description description	Trafficking protein particle complex II-specific subunit 130
Molecular weight formula_weight	128225.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,T

MDKEIYCGSVPVSYFDPFDLFESLRPEFQQILPLDNIHWKAFDGTVRTVNRLPIELIPEGRGEADKSNDEQPFIRFLIVNCISIDQYRAKVRPLVRQWLPNLESVSSSTGEKMIYKPIILLYANSEVVDSNLFKSVSLMEKFGKDFPHVQTLEVRSVYRSPKERQEFWNQFSQKIKASVLSIFQKRLTHLQHSLANLQKGNNFEEQLLTREKLYELYVVFNILEDASLELQKIKKEILRRNMNMPDGKLQVPFESSSKSDESLGSIIIEGTLDKFQLHKYFFIRRLRLLKLEDQTLTAFVGAFQLIKNFIESISIEYRKSVRLLEFKHYFITSMLSYFEFENVSNPLLCEIKAELLMLKRDNWVQGVMATSGYRLMDKNYPNSDVKYKFDLLKETFVDETVFQENFLTLTKEILSLFNKCEGKRQRIVDILSIEIGLLYYQGKKYEEAVSLFLSCYEYYTQTNKNSIGLKILQVFIDSLSHCPKLDVLQIDGESVSASAVLTNAFLNILKLCKDNDSKEIWWKKFMDLQMKNNIHLMYPLDGLFEVTLNSKVHLARANVSAIEVNLKSYGFPEDISTKTMRLSLKNMGGDVIVFGASDFLLKKGENKLILECRDIMYGEFSLLSFEIIVEGITFVKEFPENQDEFIVVPEIYCKESTKVLVKQAHNLNLGEYALELKSVQSDALESLQVEVEVQKNIGNMKNLPVSFSMDEIQARKRYNTPFENVRLEYYLLDQITAFDLIIKTSFTKKNDQGTFGETKKVRIQCYLQLSVSVEDIFKKDIFFFKFLLNSSVREEPVILYSSELSAPDTRNDYNIRGDYIATTPALITFDGNESFINCYEITANNNFDSKDIFNLKVRYNTLKEQLDCFITDAVLIEGDVEWFILFEKWKTFWELEILKKLKYDYDAFKENRIIRLLKTSIDLNKTKSKIRNLCIEKAVLDKILICLNKVSRGIAVCNTDMDEYVRNLVPKQLTVPVQLPGFEQFFHVQFEQMETSHDALHDTIATIGNSLSYTVIVENLSGQWGQDVIDDGGYIFEILSSNEWLIHGQKRCAIKEKRKEFEVHLIPLKKGYLNFPRVEITNINGKSCRVDHSNAFESILIF

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 9 Entity 9 polymer

Description description	Trafficking protein particle complex II-specific subunit 120
Molecular weight formula_weight	147807.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,U

MNILKHFPSYVGPSKIRTLVIPIGHWTRKEFNNAVQKLSEFNEIHLSDVTPIDSPIFTPQGFPHGKLFFDFLTIDHDDALELFLYDFEPFRKTFVIIGLVNDYSDPLTNLNFMKEKYPTLISPNLVYASSTPTKELEQTIDTMENVFASSPDMQKNIETIMCDIARNFLTALNSYYSSYKHVTLRSPGAIGGNAVLKTTLIRQNSYTSSSSSTPMSAVQSSVSSSSKAGSVTTASKRLSSFEMTTNSLKRSASLKLATTLSTSENRSQQKSLGRQMKILGNFQLLAGRYVDALNSFVDAITTLYKVRDYLWLGSALDGISICFLLLSYLGLSYQIPQIVSLICPVEKLNFESSSTGISPVDSNSKATASTTASSTPRNSISIAAMQSPRNSIMSLSAPALNIDVENINLPLLIKCISDKVLYYYDLSLMHNSEYAPQVVYCEFLLKTLTFMTSCYKSSEFSKDVLDNIVKNQHRALSDIPNSPMFPRFEVYFYSNKLFELQLKEMQVEAQIKIYSTMAEVYRLLGYKRKQLFVLRLLMVALLATPNKIAWHPDYRTLIDTIIELLNINESEAKINVDDPSQSTWLILQKKILQLCIKVSRKINDFEYVAKFSSILITKYTHLLNQSEQDALFKEYIQPSITNESITSYWDPFILREVVINRILDSDPTSNEIPLESDVSSLESLENRQKTQDINPQEVFNPFKRVQPTSFVSNNSTKVPILVFLVGDKAEFTCRVQNPFKFDFTINDIQLDEEISEFCEIDRKAVSYSGPYNVKAESIRSITLPLIIKKPTYKKIYEISCLKISILKLPLQKFDIINDSRRSNPVEEEAEYSKCIYGKLKIKILPEQPQLELLSTSKMTRNSWMMLDGTKTDFHITVRNKSLSCAINHIKIIPMNNIEQMLKPDYWKKMPPDDLYIMEKQLDWLSKSCVRIIKLPTVIKPNETITFDLELDNTAVPFNFTGFDLLIEYGMSATDESCIYLKKLSIPYEVTLRRTIEVPSMDIIPLNELFSSQVENVDWIEYVMSKIRAESNLHSRDFILLLLDFRNSWIDGIKLNVQFEDFTSNEYHVEASHTSRIIVPIKKIDYKKYNFENTPIPRIFPGRQFIQSGLNEEQTIEMRQKFWCREHIISKLKCNWKLTTDQSVTGSVDFNKFIEKFDHKMVYTIYPGRLFYGVQLLLDEPKVKVGEIINLKIITEPTSTCRRKQNSTVNFLDIVIFDSKTSKILPRSNRRILYNGSLTKPISTTKVSEINLEIIPIEKGRYEFSVCISKSNNQDGIIQFDSENVILSVI

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 10 Entity 10 polymer

Description description	Trafficking protein particle complex II-specific subunit 65
Molecular weight formula_weight	63434.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,V

MECFVPLRCDLDGSNIEQLRQSHLSRKFIIFDEQLNLWLWFQGNSQENKRFVLQNMIILINEAQVTRTSTIDDYFTQVENNENLWRLKNDCCSKILFKSNVVMNNGYNNQIKFVFEYKSVDANFNNQDSLQDPQAKYTLDKYSSEEILPSFEPVYSWSSAATKSSKNTNNHLEKNNRATHRVSSKNSEVHEADVSRNPNTFTLKLQYPIFSLLNMRLRNISLKSEHCILSSLDFQTSKASEQLTKKFIYPQEHNSFLKLNFQEISYKLIDGTSQIELDPICPLKVPLTAFSYDSISATFKLVLLPKSTQPHRVKITLAYELELHPNLKLPVRTSWETEVTLKRSMPISSTSSQYSSNNNNTNHSASFNGAANNVNSGGLANLRLGGVSSSRFSLGAASTTSLVNSKLSNVKFKFINSNIKVIKGEKFTMRLQIINSSSSPLDLVVYYNNTINPIPSANNVRNSNGINNCGMNNGTIPNSPLTLENQYQLHNKYRKIAEGIILLSNDYKIPVVPPRETYFADLRFIGIMSGYYGTLSGLKVLDLNTNELIEVGNGASVLIQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

▶

Resolution resolution	4.36 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	36751

Intact TRAPPII (state I).

1. Protein Identity and Related Structures Protein Identity & Related Structures

TRAPP-associated protein TCA17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit 33

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit BET3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit BET5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit 23

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit 31

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit 20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex II-specific subunit 130

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex II-specific subunit 120

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex II-specific subunit 65

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer