SAXSdb — 7eqz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxypeptidase B

Aedes aegypti

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Metallocarboxypeptidase inhibitor × 1 （P01075） ZINC ION × 1 GLYCINE × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6J661_AEDAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–299； UniProt 114–412

Metallocarboxypeptidase inhibitor

OrganismNot specified

UniProt P01075

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Carboxypeptidase B × 1 （Q6J661） ZINC ION × 1 GLYCINE × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCPI_SOLTU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–36； UniProt 3–38

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7eqz
Deposition date deposition_date	2021-05-05
Structure title title	Crystal structure of Carboxypeptidase B complexed with Potato Carboxypeptidase Inhibitor
Keywords keywords	ANTIVIRAL PROTEIN, Hydrolase-Hydrolase inhibitor complex; Hydrolase/Hydrolase inhibitor
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7eqz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7eqz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7eqz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.52 Å
Rg (electron density)	18.38 Å
Total Rg	19.39 Å
Atom count	2579
Residues	334
Excluded volume	45454 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7eqz__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Carboxypeptidase B
Molecular weight formula_weight	32930.7 kDa
EC 编号 ec_number	3.4.17.2
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2779

DVSTSYLRHNEINEYLQTLSQKYPSLVSVEEAGTSYEGRSIKTITINKKPGNAVVFLDAGIHAREWIAPATALYAIEQLVEHSSENQEVLSNLTWVIMPVVNPDGYEFSHETDRFWRKTRKPTGKSCKGTDGNRNFDYHWGEVGASTQACADTFRGETAFSEPETRAVRDAVMKLKGSCKFYLSLHSYGNYILYPWGWTSKLPETWEAIDEVAQAGAEAIKQSTGSRYTVGSSTNVLYAAAGGSDDWAFAVAEVPISITMELPGGGNGGFNPPPSSIEKIVNESWVGIKAMALKVAQMF

Source Source

Source organism organism	Aedes aegypti
Common name common_name	Yellowfever mosquito, Culex aegypti
NCBI taxonomy ID ncbi_taxonomy_id	7159
Host organism host_organism	Escherichia coli K-12

Entity 2 Entity 2 polymer

Description description	Metallocarboxypeptidase inhibitor
Molecular weight formula_weight	3991.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

HADPICNKPCKTHDDCSGAWFCQACWNSARTCGPYV

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	GLYCINE
Molecular weight formula_weight	75.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	200

▶

Unit-cell length a length_a	40.451 Å
Unit-cell length b length_b	87.208 Å
Unit-cell length c length_c	49.069 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	107.70 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	31.890 Å
R factor r_factor	0.1586
R_work r_work	0.1545
R_free r_free	0.1959

Crystal structure of Carboxypeptidase B complexed with Potato Carboxypeptidase Inhibitor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxypeptidase B

State in the Current Structure

Other States of the Same Protein in the Database

Metallocarboxypeptidase inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7eqz__assembly_1__model_1

7eqz__assembly_1__model_1 | I(q)

7eqz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of Carboxypeptidase B complexed with Potato Carboxypeptidase Inhibitor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Carboxypeptidase B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Metallocarboxypeptidase inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7eqz__assembly_1__model_1

7eqz__assembly_1__model_1 | I(q)

7eqz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)