7ew6

Barley photosystem I-LHCI-Lhca5 supercomplex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1K7_HORVS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–750； UniProt 1–750

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt S4Z289

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z289_HORVS
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–734； UniProt 1–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt S4YZ47

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4YZ47_HORVS
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II, chloroplastic

OrganismNot specified

UniProt P36213

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_HORVU
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–205； UniProt 1–205

Photosystem I reaction center subunit IV, chloroplastic

OrganismNot specified

UniProt P13194

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_HORVU
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–147； UniProt 1–147

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt P13192

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_HORVU
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–235； UniProt 1–235

Photosystem I reaction center subunit VI, chloroplastic

OrganismNot specified

UniProt P20143

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAH_HORVU
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–143； UniProt 1–143

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt S4Z1D9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1D9_HORVS
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–36； UniProt 1–36

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt S4Z1E9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1E9_HORVS
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42

Photosystem I reaction center subunit psaK, chloroplastic

OrganismNot specified

UniProt P36886

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK_HORVU
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–131； UniProt 1–131

Photosystem I reaction center subunit XI, chloroplastic

OrganismNot specified

UniProt P23993

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_HORVU
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–209； UniProt 1–209

Chlorophyll a-b binding protein Lhca1

OrganismNot specified

UniProt A0A287WC32

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287WC32_HORVV
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 1； PDBConstruct 1–247； UniProt 39–285

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q43485

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q43485_HORVU
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 2； PDBConstruct 1–255； UniProt 1–255

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt F2DAN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 1 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 1 （P13194） Photosystem I reaction center subunit III, chloroplastic × 1 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 1 （P20143） Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 1 （P23993） Chlorophyll a-b binding protein Lhca1 × 1 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein Lhca5 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 136 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 5 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2DAN8_HORVV
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 3； PDBConstruct 1–269； UniProt 1–269

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ew6
Deposition date deposition_date	2021-05-24
Structure title title	Barley photosystem I-LHCI-Lhca5 supercomplex
Keywords keywords	Photosystem I, Light-harvesting complex, Lhca5, Photosynthesis; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ew6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ew6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ew6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.53 Å
Rg (electron density)	50.88 Å
Total Rg	51.01 Å
Atom count	32973
Residues	3108
Excluded volume	608220 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ew6__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (26)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83217.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	32973

MIIRSPEPEVKIVVDRDPVKTSFEEWARPGHFSRTLAKGPDTTTWIWNLHADAHDFDSHTGDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQLWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINQFLDAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGLKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNIHATAPGVTAPGATTSTSLTWGGGELVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGTISDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82693.9 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MELRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFESWIQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAAGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSTLSLIASWLHLQPKWKPSLSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIPASRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPDSSNHLFGTAQGAGTAILTLLGGFHPQTQSLWLTDMAHHHLAIAFIFLIAGHMYRTNFGIGHSIKDLLEAHTPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPPYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDILLSSTNGPAFNAGRSLWLPGWLNAVNENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8909.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGPETTRSMALSY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	21958.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAMATQASAATRHLITAAWSPSAKPRPATLAMPSSARGPAPLFAAAPDTPAPAAPPAEPAPAGFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKNSFDI

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	15476.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MASTNMASATSRFMLAAGIPSGANGGVSSRVSFLPSNRLGLKLVARAEEPTAAAPAEPAPAADEKPEAAVATKEPAKAKPPPRGPKRGTKVKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIKEVAA

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	24866.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAALAASIATSTAFAAKPRLSRPPARLSVSCSASSGDNNNSTATPSLSASIKTFSAALALSSVLLSSAATSPPPAAADIAGLTPCKESKAFAKREKQSVKKLNSSLKKYAPDSAPALAIQATIDKTKRRFENYGKFGLLCGSDGLPHLIVSGDQRHWGEFITPGVLFLYIAGWIGWVGRSYLIAVSGEKKPAMREIIIDVELAARIIPRGFIWPVAAYRELINGDLVVDDADIGY

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VI, chloroplastic
Molecular weight formula_weight	14900.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MASLVAVQPAAVKGLSGSSISGRKLAVRPSSAAVSRSTRRARGAAVVAKYGEKSVYFDLDDIANTTGQWDLYGSDAPSPYNGLQSKFFNTFAAPFTKRGLLLKFLLIGGGSLVAYVSASASPDLLPIKKGPQLPPTPGPRGKI

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4010.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTDLNLPSIFVPLVGLVFPAIAMTSLFLYVQKKKIV

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4747.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDIKTYLSVAPVLSTLWFGALAGLLIEINRLFPDALSFPFF

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	13742.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MASQLSAMTSVPQFHGLRTYSSPRSMATLPSLRRRRSQGIRCDYIGSSTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARESGLQTGDPAGFTLADTLACGAVGHIMGVGIVLGLKNTGVLDQIIG

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit XI, chloroplastic
Molecular weight formula_weight	22229.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MATAYAPPMASQVMKSGLACSKPRGMSGASLTRRPRFVVKAVKSDKPTYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALTGPLRNTPVHGQAGTLGAIGLVSILSVCLTMYGVASFNEGEPSTAPVLTLTGRKKEADKLQTAEGWSQFTGGFFFGGVSGAVWAYFLLYVLDLPYFFK

Entity 12 Entity 12 polymer

Description description	Chlorophyll a-b binding protein Lhca1
Molecular weight formula_weight	26691.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MAMASSSGLRSCSAVGVPSLLAPSSRSGRSGLPFCAYATTSGRVTMSAEWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEKKKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIPRNIYGP

Entity 13 Entity 13 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	27320.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MALVSSSSATAVAALPSNGLAGARTSFLGAAGKAAASRTSFAVRAAAPERPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELILIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGYGTGSPEKLKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFRAFAPK

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	29374.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MAAQGLLSGRQLLGRPLQSSFSRSSSSRKSPFVVRASSSPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGLSDPEGTGGFIEPRWLAYGEIFNGRTAMMGVVGMIAPEALGKVGLVPPETAIPWFQAGAIPPAGTYQYWADPYTLFVFEMALIGFAEHRRLQDWYNPGSMGKQYFLGLEKYLGGSGDPAYPGGPIFNPLGFGTKSEKEMKELKLKEIKNGRLAMLAFLGMSLQAIFTGVGPFQNLLDHLSDPVNNNILTSLKFH

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein Lhca5
Molecular weight formula_weight	27618.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MALAANAHGRVCTLSSRPPAPFSSRSTVAMPGHHSESPRARFAVRAIAERATWLPGLDPPAYLDGTLPGDYGFDPLGLGEQPEDLKWYVQAELVHCRFAMAGVAGILGTDLIRVSGIGNLPVWFEAGATKFDFANTTALFFVQLLLMGFVETKRYMDFVSPGSQAKEGTFLGIEASLEGLQPGYPGGPLFNPMGLAKDIENANEVKLKEIKNGRLAMVAMLGFIVQASVTHAGPIDNLLTHLSDPFNKNIIHALTLS

Entity 16 Entity 16 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	136

Entity 18 Entity 18 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 20 Entity 20 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	25

Entity 21 Entity 21 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 22 Entity 22 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 23 Entity 23 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 24 Entity 24 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 25 Entity 25 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 26 Entity 26 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	103844

Barley photosystem I-LHCI-Lhca5 supercomplex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VI, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit psaK, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer