7ewk

Barley photosystem I-LHCI-Lhca6 supercomplex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 Photosystem I reaction center subunit D × 1 Photosystem I reaction center subunit E × 1 Photosystem I reaction center subunit F × 1 Photosystem I reaction center subunit H × 1 Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit K × 1 Photosystem I reaction center subunit L × 1 Chlorophyll a-b binding protein Lhca1 × 1 Chlorophyll a-b binding protein Lhca3 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q9LKC7） Chlorophyll a-b binding protein Lhca6 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 137 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 11 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1K7_HORVS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–742； UniProt 9–750

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt S4Z289

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I iron-sulfur center × 1 Photosystem I reaction center subunit D × 1 Photosystem I reaction center subunit E × 1 Photosystem I reaction center subunit F × 1 Photosystem I reaction center subunit H × 1 Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit K × 1 Photosystem I reaction center subunit L × 1 Chlorophyll a-b binding protein Lhca1 × 1 Chlorophyll a-b binding protein Lhca3 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q9LKC7） Chlorophyll a-b binding protein Lhca6 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 137 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 11 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z289_HORVS
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–733； UniProt 2–734

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt S4Z1D9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 Photosystem I reaction center subunit D × 1 Photosystem I reaction center subunit E × 1 Photosystem I reaction center subunit F × 1 Photosystem I reaction center subunit H × 1 Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit K × 1 Photosystem I reaction center subunit L × 1 Chlorophyll a-b binding protein Lhca1 × 1 Chlorophyll a-b binding protein Lhca3 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q9LKC7） Chlorophyll a-b binding protein Lhca6 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 137 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 11 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1D9_HORVS
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–30； UniProt 5–34

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt S4Z1E9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 Photosystem I reaction center subunit D × 1 Photosystem I reaction center subunit E × 1 Photosystem I reaction center subunit F × 1 Photosystem I reaction center subunit H × 1 Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit K × 1 Photosystem I reaction center subunit L × 1 Chlorophyll a-b binding protein Lhca1 × 1 Chlorophyll a-b binding protein Lhca3 × 1 Chlorophyll a-b binding protein, chloroplastic × 1 （Q9LKC7） Chlorophyll a-b binding protein Lhca6 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 137 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 11 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1E9_HORVS
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q9LKC7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （S4Z289） Photosystem I iron-sulfur center × 1 Photosystem I reaction center subunit D × 1 Photosystem I reaction center subunit E × 1 Photosystem I reaction center subunit F × 1 Photosystem I reaction center subunit H × 1 Photosystem I reaction center subunit VIII × 1 （S4Z1D9） Photosystem I reaction center subunit IX × 1 （S4Z1E9） Photosystem I reaction center subunit K × 1 Photosystem I reaction center subunit L × 1 Chlorophyll a-b binding protein Lhca1 × 1 Chlorophyll a-b binding protein Lhca3 × 1 Chlorophyll a-b binding protein Lhca6 × 1 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 137 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 25 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 6 CHLOROPHYLL B × 11 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9LKC7_HORVU
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 4； PDBConstruct 1–197； UniProt 29–225

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ewk
Deposition date deposition_date	2021-05-25
Structure title title	Barley photosystem I-LHCI-Lhca6 supercomplex
Keywords keywords	Photosystem I, Light-harvesting complex, Lhca6, cyclic electron transport, Photosynthesis; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ewk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ewk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ewk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.80 Å
Rg (electron density)	51.37 Å
Total Rg	51.55 Å
Atom count	32765
Residues	3110
Excluded volume	601800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ewk__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (26)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82292.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	32765

EVKIVVDRDPVKTSFEEWARPGHFSRTLAKGPDTTTWIWNLHADAHDFDSHTGDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQLWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINQFLDAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGLKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNIHATAPGVTAPGATTSTSLTWGGGELVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGTISDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82562.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ELRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFESWIQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAAGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSTLSLIASWLHLQPKWKPSLSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIPASRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPDSSNHLFGTAQGAGTAILTLLGGFHPQTQSLWLTDMAHHHLAIAFIFLIAGHMYRTNFGIGHSIKDLLEAHTPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPPYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDILLSSTNGPAFNAGRSLWLPGWLNAVNENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8909.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGPETTRSMALSY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit D
Molecular weight formula_weight	15801.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

GFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKNSFD

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit E
Molecular weight formula_weight	7679.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

KPPPRGPKRGTKVKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIKEVA

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit F
Molecular weight formula_weight	17488.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCKESKAFAKREKQSVKKLNSSLKKYAPDSAPALAIQATIDKTKRRFENYGKFGLLCGSDGLPHLIVSGDQRHWGEFITPGVLFLYIAGWIGWVGRSYLIAVSGEKKPAMREIIIDVELAARIIPRGFIWPVAAYRELINGDLVVDDADIGY

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit H
Molecular weight formula_weight	6431.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

LQSKFFNTFAAPFTKRGLLLKFLLIGGGSLVAYVSASASPDLLPIKKGPQLPPTPGPRGKI

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3338.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

NLPSIFVPLVGLVFPAIAMTSLFLYVQKKK

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4747.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MRDIKTYLSVAPVLSTLWFGALAGLLIEINRLFPDALSFPFF

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit K
Molecular weight formula_weight	8502.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

YIGSSTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARESGLQTGDPAGFTLADTLACGAVGHIMGVGIVLGLKNTGVLD

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit L
Molecular weight formula_weight	15512.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

SLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALTGPLRNTPVHGQAGTLGAIGLVSILSVCLTMYGVASFNEGEPSTAPVLTLTGRKKEADKLQTAEGWSQFTGGFFFGGVSGAVWAYFLLYVLDLPYFF

Entity 12 Entity 12 polymer

Description description	Chlorophyll a-b binding protein Lhca1
Molecular weight formula_weight	21278.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

EWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEKKKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIP

Entity 13 Entity 13 polymer

Description description	Chlorophyll a-b binding protein Lhca3
Molecular weight formula_weight	24395.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

RQLWFASKQSLTYLDGTLPGDFGFDPLGLSDPEGTGGFIEPRWLAYGEIFNGRTAMMGVVGMIAPEALGKVGLVPPETAIPWFQAGAIPPAGTYQYWADPYTLFVFEMALIGFAEHRRLQDWYNPGSMGKQYFLGLEKYLGGSGDPAYPGGPIFNPLGFGTKSEKEMKELKLKEIKNGRLAMLAFLGMSLQAIFTGVGPFQNLLDHLSDPVNNNILTSLKFH

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	21976.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

KGSWLPGLQSPAYLDGSLAGDNGFDPLALAEDPEDLRWFVQAELVNGRWAMLGVAGMLIPEVLTKAGLLNAPEWYDAGKETYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGSVFNPLNFAPTLENKEKELANGRLAMLAFLGFLVQHNVTGKGPFENLQQHLADPWHNTIIQTI

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein Lhca6
Molecular weight formula_weight	23904.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

TVCEPLGPDRPVWFPGTAPPPWLDGSLPGDFGFDPLGFGSEPESLRWFAQAELMHGRWAMLAVAGILIPEILQKWGFMEEFSWYTAGEREYFADPWTLFVTQMALMGWVEGRRWMDYLNPGSVDIEPRFPNRKNPTPDVGYPGGLWFDWGNWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQVVYTGQGPLDNLFAHLADPGHCNIFSA

Entity 16 Entity 16 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	137

Entity 18 Entity 18 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 20 Entity 20 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	25

Entity 21 Entity 21 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 22 Entity 22 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 23 Entity 23 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 24 Entity 24 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 25 Entity 25 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 26 Entity 26 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

Domain ID domain_id	7ewk101
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7ewk301
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7ewk401
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7ewk601
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	7ewkL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.88 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	103844

Barley photosystem I-LHCI-Lhca6 supercomplex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ewk__assembly_1__model_1

7ewk__assembly_1__model_1 | I(q)

7ewk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (26)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer