7f9o

PSI-NDH supercomplex of Barley

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1K7_HORVS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–750； UniProt 1–750 Author chain e； PDBConstruct 1–750； UniProt 1–750

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt S4Z289

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z289_HORVS
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–734； UniProt 1–734 Author chain f； PDBConstruct 1–734； UniProt 1–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt S4YZ47

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4YZ47_HORVS
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81 Author chain g； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II, chloroplastic

OrganismNot specified

UniProt P36213

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_HORVU
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–205； UniProt 1–205 Author chain h； PDBConstruct 1–205； UniProt 1–205

Photosystem I reaction center subunit IV, chloroplastic

OrganismNot specified

UniProt P13194

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_HORVU
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–147； UniProt 1–147 Author chain i； PDBConstruct 1–147； UniProt 1–147

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt P13192

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_HORVU
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–235； UniProt 1–235 Author chain j； PDBConstruct 1–235； UniProt 1–235

Photosystem I reaction center subunit VI, chloroplastic

OrganismNot specified

UniProt P20143

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAH_HORVU
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–143； UniProt 1–143 Author chain k； PDBConstruct 1–143； UniProt 1–143

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt S4Z1D9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1D9_HORVS
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–36； UniProt 1–36 Author chain l； PDBConstruct 1–36； UniProt 1–36

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt S4Z1E9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1E9_HORVS
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42 Author chain m； PDBConstruct 1–42； UniProt 1–42

Photosystem I reaction center subunit psaK, chloroplastic

OrganismNot specified

UniProt P36886

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK_HORVU
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–131； UniProt 1–131 Author chain n； PDBConstruct 1–131； UniProt 1–131

Photosystem I reaction center subunit XI, chloroplastic

OrganismNot specified

UniProt P23993

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_HORVU
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–209； UniProt 1–209 Author chain o； PDBConstruct 1–209； UniProt 1–209

Chlorophyll a-b binding protein Lhca1

OrganismNot specified

UniProt A0A287WC32

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287WC32_HORVV
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 1； PDBConstruct 1–247； UniProt 39–285 Author chain p； PDBConstruct 1–247； UniProt 39–285

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q43485

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q43485_HORVU
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 2； PDBConstruct 1–255； UniProt 1–255

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt F2DAN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2DAN8_HORVV
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 3； PDBConstruct 1–269； UniProt 1–269 Author chain q； PDBConstruct 1–269； UniProt 1–269

NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic

OrganismNot specified

UniProt P92432

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1C_HORVU
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain G； PDBConstruct 1–346； UniProt 15–360

NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic

OrganismNot specified

UniProt S4Z268

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z268_HORVS
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain M； PDBConstruct 1–483； UniProt 28–510

NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic

OrganismNot specified

UniProt S4Z1L1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1L1_HORVS
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain N； PDBConstruct 1–117； UniProt 4–120

NAD(P)H-quinone oxidoreductase chain 4, chloroplastic

OrganismNot specified

UniProt S4Z8N2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z8N2_HORVS
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain O； PDBConstruct 1–499； UniProt 2–500

NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

OrganismNot specified

UniProt S4Z1I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z1I1_HORVS
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain P； PDBConstruct 1–100； UniProt 1–100

NADH-plastoquinone oxidoreductase subunit 5

OrganismNot specified

UniProt A0A7T7JN26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7T7JN26_HORVU
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain Q； PDBConstruct 1–777； UniProt 1–777

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

OrganismNot specified

UniProt A0A4Y5SEJ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4Y5SEJ9_HORVS
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain R； PDBConstruct 1–176； UniProt 1–176

NAD(P)H-quinone oxidoreductase subunit H, chloroplastic

OrganismNot specified

UniProt S4Z272

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z272_HORVS
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain S； PDBConstruct 1–383； UniProt 11–393

NAD(P)H-quinone oxidoreductase subunit I, chloroplastic

OrganismNot specified

UniProt A0A218LNN1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A218LNN1_HORVU
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain T； PDBConstruct 1–165； UniProt 3–167

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

OrganismNot specified

UniProt Q7GT16

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHJ_HORVU
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain U； PDBConstruct 1–159； UniProt 1–159

NAD(P)H-quinone oxidoreductase subunit K, chloroplastic

OrganismNot specified

UniProt S4Z232

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S4Z232_HORVS
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain V； PDBConstruct 1–245； UniProt 1–245

NAD(P)H-quinone oxidoreductase subunit L, chloroplastic

OrganismNot specified

UniProt F2CUR7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2CUR7_HORVV
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain W； PDBConstruct 1–192； UniProt 1–192

NAD(P)H-quinone oxidoreductase subunit M, chloroplastic

OrganismNot specified

UniProt F2D138

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2D138_HORVV
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain X； PDBConstruct 1–213； UniProt 1–213

NAD(P)H-quinone oxidoreductase subunit N, chloroplastic

OrganismNot specified

UniProt A0A287M953

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287M953_HORVV
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain Y； PDBConstruct 1–233； UniProt 31–263

Photosynthetic NDH subunit of subcomplex L2

OrganismNot specified

UniProt F2CTW7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2CTW7_HORVV
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain b； PDBConstruct 1–216； UniProt 1–216

Photosynthetic NDH subunit of subcomplex L5

OrganismNot specified

UniProt F2CTD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2CTD7_HORVV
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain d； PDBConstruct 1–243； UniProt 1–243

Photosynthetic NDH subunit of subcomplex B1

OrganismNot specified

UniProt F2D3G1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2D3G1_HORVV
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain 6； PDBConstruct 1–469； UniProt 1–469

Photosynthetic NDH subunit of subcomplex B2

OrganismNot specified

UniProt F2D932

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2D932_HORVV
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain 7； PDBConstruct 1–361； UniProt 1–361

Photosynthetic NDH subunit of subcomplex B3

OrganismNot specified

UniProt F2DD79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2DD79_HORVV
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain 8； PDBConstruct 1–119； UniProt 78–196

Photosynthetic NDH subunit of subcomplex B5

OrganismNot specified

UniProt F2DWH9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2DWH9_HORVV
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain 0； PDBConstruct 1–155； UniProt 61–215

Chlorophyll a-b binding protein Lhca4

OrganismNot specified

UniProt Q9LKC7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein, chloroplastic × 1 （F2D0D5） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9LKC7_HORVU
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain r； PDBConstruct 1–197； UniProt 29–225

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt F2D0D5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 55	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （S4Z1K7） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （S4Z289） Photosystem I iron-sulfur center × 2 （S4YZ47） Photosystem I reaction center subunit II, chloroplastic × 2 （P36213） Photosystem I reaction center subunit IV, chloroplastic × 2 （P13194） Photosystem I reaction center subunit III, chloroplastic × 2 （P13192） Photosystem I reaction center subunit VI, chloroplastic × 2 （P20143） Photosystem I reaction center subunit VIII × 2 （S4Z1D9） Photosystem I reaction center subunit IX × 2 （S4Z1E9） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P36886） Photosystem I reaction center subunit XI, chloroplastic × 2 （P23993） Chlorophyll a-b binding protein Lhca1 × 2 （A0A287WC32） Chlorophyll a-b binding protein, chloroplastic × 1 （Q43485） Chlorophyll a-b binding protein, chloroplastic × 2 （F2DAN8） Chlorophyll a-b binding protein Lhca5 × 1 NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （P92432） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （S4Z268） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （S4Z1L1） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （S4Z8N2） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （S4Z1I1） NADH-plastoquinone oxidoreductase subunit 5 × 1 （A0A7T7JN26） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （A0A4Y5SEJ9） NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （S4Z272） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （A0A218LNN1） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （Q7GT16） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （S4Z232） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （F2CUR7） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （F2D138） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （A0A287M953） Unidentified stromal protein × 1 Photosynthetic NDH subunit of subcomplex L1 × 1 Photosynthetic NDH subunit of subcomplex L2 × 1 （F2CTW7） Photosynthetic NDH subunit of subcomplex L2 × 1 Photosynthetic NDH subunit of subcomplex L4 × 1 Photosynthetic NDH subunit of subcomplex L5 × 1 （F2CTD7） Photosynthetic NDH subunit of subcomplex B1 × 1 （F2D3G1） Photosynthetic NDH subunit of subcomplex B2 × 1 （F2D932） Photosynthetic NDH subunit of subcomplex B3 × 1 （F2DD79） Photosynthetic NDH subunit of subcomplex B4 × 1 Photosynthetic NDH subunit of subcomplex B5 × 1 （F2DWH9） Chlorophyll a-b binding protein Lhca4 × 1 （Q9LKC7） CHLOROPHYLL A ISOMER × 2 CHLOROPHYLL A × 273 PHYLLOQUINONE × 4 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 11 BETA-CAROTENE × 51 IRON/SULFUR CLUSTER × 7 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 4 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 7 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 CHLOROPHYLL B × 23 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2D0D5_HORVV
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain s； PDBConstruct 1–211； UniProt 56–266

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7f9o
Deposition date deposition_date	2021-07-04
Structure title title	PSI-NDH supercomplex of Barley
Keywords keywords	Photosystem I, NDH, Photosynthesis; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7f9o__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7f9o__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7f9o__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	105.00 Å
Total Rg	104.60 Å
Atom count	106329
Residues	11614
Excluded volume	1939100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7f9o__assembly_1__model_1`	55-meric （55）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (54)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83217.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,e
Atom count atom_count	106329

MIIRSPEPEVKIVVDRDPVKTSFEEWARPGHFSRTLAKGPDTTTWIWNLHADAHDFDSHTGDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQLWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINQFLDAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGLKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNIHATAPGVTAPGATTSTSLTWGGGELVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGTISDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82693.9 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,f

MELRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFESWIQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAAGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSTLSLIASWLHLQPKWKPSLSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIPASRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPDSSNHLFGTAQGAGTAILTLLGGFHPQTQSLWLTDMAHHHLAIAFIFLIAGHMYRTNFGIGHSIKDLLEAHTPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPPYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDILLSSTNGPAFNAGRSLWLPGWLNAVNENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8909.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,g

MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGPETTRSMALSY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	21958.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,h

MAMATQASAATRHLITAAWSPSAKPRPATLAMPSSARGPAPLFAAAPDTPAPAAPPAEPAPAGFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKNSFDI

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	15476.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,i

MASTNMASATSRFMLAAGIPSGANGGVSSRVSFLPSNRLGLKLVARAEEPTAAAPAEPAPAADEKPEAAVATKEPAKAKPPPRGPKRGTKVKILRRESYWYNGTGSVVTVDQDPNTRYPVVVRFAKVNYAGVSTNNYALDEIKEVAA

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	24866.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,j

MAALAASIATSTAFAAKPRLSRPPARLSVSCSASSGDNNNSTATPSLSASIKTFSAALALSSVLLSSAATSPPPAAADIAGLTPCKESKAFAKREKQSVKKLNSSLKKYAPDSAPALAIQATIDKTKRRFENYGKFGLLCGSDGLPHLIVSGDQRHWGEFITPGVLFLYIAGWIGWVGRSYLIAVSGEKKPAMREIIIDVELAARIIPRGFIWPVAAYRELINGDLVVDDADIGY

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VI, chloroplastic
Molecular weight formula_weight	14900.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,k

MASLVAVQPAAVKGLSGSSISGRKLAVRPSSAAVSRSTRRARGAAVVAKYGEKSVYFDLDDIANTTGQWDLYGSDAPSPYNGLQSKFFNTFAAPFTKRGLLLKFLLIGGGSLVAYVSASASPDLLPIKKGPQLPPTPGPRGKI

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4010.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,l

MTDLNLPSIFVPLVGLVFPAIAMTSLFLYVQKKKIV

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4747.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,m

MRDIKTYLSVAPVLSTLWFGALAGLLIEINRLFPDALSFPFF

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	13742.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,n

MASQLSAMTSVPQFHGLRTYSSPRSMATLPSLRRRRSQGIRCDYIGSSTNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARESGLQTGDPAGFTLADTLACGAVGHIMGVGIVLGLKNTGVLDQIIG

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit XI, chloroplastic
Molecular weight formula_weight	22229.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,o

MATAYAPPMASQVMKSGLACSKPRGMSGASLTRRPRFVVKAVKSDKPTYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALTGPLRNTPVHGQAGTLGAIGLVSILSVCLTMYGVASFNEGEPSTAPVLTLTGRKKEADKLQTAEGWSQFTGGFFFGGVSGAVWAYFLLYVLDLPYFFK

Entity 12 Entity 12 polymer

Description description	Chlorophyll a-b binding protein Lhca1
Molecular weight formula_weight	26691.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,p

MAMASSSGLRSCSAVGVPSLLAPSSRSGRSGLPFCAYATTSGRVTMSAEWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEKKKYPGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIPRNIYGP

Entity 13 Entity 13 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	27320.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MALVSSSSATAVAALPSNGLAGARTSFLGAAGKAAASRTSFAVRAAAPERPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELILIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGYGTGSPEKLKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFRAFAPK

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	29374.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,q

MAAQGLLSGRQLLGRPLQSSFSRSSSSRKSPFVVRASSSPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGLSDPEGTGGFIEPRWLAYGEIFNGRTAMMGVVGMIAPEALGKVGLVPPETAIPWFQAGAIPPAGTYQYWADPYTLFVFEMALIGFAEHRRLQDWYNPGSMGKQYFLGLEKYLGGSGDPAYPGGPIFNPLGFGTKSEKEMKELKLKEIKNGRLAMLAFLGMSLQAIFTGVGPFQNLLDHLSDPVNNNILTSLKFH

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein Lhca5
Molecular weight formula_weight	27618.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MALAANAHGRVCTLSSRPPAPFSSRSTVAMPGHHSESPRARFAVRAIAERATWLPGLDPPAYLDGTLPGDYGFDPLGLGEQPEDLKWYVQAELVHCRFAMAGVAGILGTDLIRVSGIGNLPVWFEAGATKFDFANTTALFFVQLLLMGFVETKRYMDFVSPGSQAKEGTFLGIEASLEGLQPGYPGGPLFNPMGLAKDIENANEVKLKEIKNGRLAMVAMLGFIVQASVTHAGPIDNLLTHLSDPFNKNIIHALTLS

Entity 16 Entity 16 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic
Molecular weight formula_weight	38544.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

SKLELLKEVYGLISILPILTLLLGITIEVLVIVWLEREISASIQQRIGPEYAGPLGLLQAIADGTKLLFKEDILPSRGDISLFSIGPSIAVISVLLSFLVIPLGYHFVLADLSIGVFLWIAISSIAPIGLLMAGYSSNNKYSFLGGLRAAAQSISYEIPLTFCVLAISLLSNSLSTVDIVEAQSKYGFFGWNIWRQPIGFLVFLISSLAECERLPFDLPEAEEELVAGYQTEYSGIKYGLFYLVSYLNLLVSSLFVTVLYLGGWNFSIPYISFFDFFQMNKAVGILEMTMGIFITLTKAYLFLFISITIRWTLPRMRMDQLLNLGWKFLLPISLGNLLLTTSFQLV

Entity 17 Entity 17 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic
Molecular weight formula_weight	53452.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

NGSFIFPECILIFGLILLLMIDSTSDQKDRPWFYFISSTSLVISITALLFRWREEPIISFSGNFQTNNFNEIFQFLILLCSTLCIPLSVEYIECTEMAITEFLLFVLTATLGGMFLCGANDLITIFVAPECFSLCSYLLSGYTKRDLRSNEATMKYLLMGGASSSILVHGFSWLYGSSGGEIELQEIVNGLINTQMYNSPGISIALISITVGLGFKLSPAPFHQWTPDVYEGSPTPVVAFLSVTSKVAASASATRILDIPFYFSSNEWHLLLEILAILSMILGNLLAITQTSMKRMLAYSSIGQIGYVIIGIIVGDSNDGYASMITYMLFYISMNLGTFACIVLFGLRTGTDNIRDYAGLYMKDPFLALSLALCLLSLGGLPPLAGFFGKLYLFWCGWQAGLYFLVSIGLLTSVLSIYYYLKIIKLLMTGRNQEITPYVRNYRRSPLRSNNSIELSMTVCVIASTIPGISMNPILAIAQDTLF

Entity 18 Entity 18 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic
Molecular weight formula_weight	13299.6 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

LHEYDIFWTFLIIASLIPILAFSISGLLAPVSEGPEKLSSYESGIEPMGGAWVQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILVVGLVYAWRKGALEWS

Entity 19 Entity 19 polymer

Description description	NAD(P)H-quinone oxidoreductase chain 4, chloroplastic
Molecular weight formula_weight	56222.8 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

SYFPWLTILVVLPIFAGSLIFFLPHKGNKIVRWYTISICLLEFLLMTYAFCYHFQLEDPLIQLKEDYKWIDVFDFHWRLGIDGLSLGSILLTGFITTLATLAAWPITRNSRLFYFLMLAMYSGQIGLFSSRDLLLFFIMWELELIPVYLLLSMWGGKRRLYSATKFILYTAGGSIFFLIGVLGMGLYGSNEPGLDLERLINQSYPATLEILLYFGFLIAYAVKLPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHYLFSPWLVIIGAIQIIYAASTSLGQRNFKKRIAYSSVSHMGFIIIGIGSITNIGLNGAILQILSHGFIGATLFFLAGTASDRMRLVYLEELGGISIPMPKIFTMFSSFSMASLALPGMSGFVAELVVFFGLITSPKFLLMPKALITFVMAIGMILTPIYLLSMLRQMFYGYKLFNVPNANFVDSGPRELFILICIFLPVIGIGIYPDFVLSLSVDRVEALLSNYYPK

Entity 20 Entity 20 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic
Molecular weight formula_weight	11199.2 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGDIFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNLLN

Entity 21 Entity 21 polymer

Description description	NADH-plastoquinone oxidoreductase subunit 5
Molecular weight formula_weight	87552.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MKNSSIFSYSFYLFFQKEIRVGLVNRKQFYRKIEVKIAISFLMEHTYQYAWVIPLLPLPVIMSMGFGLILIPTATKNLRRIWAFPSVLLLSIAMVFSVQLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMLILITTVGILVLIYSDGYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRPIAASACQKAFVTNRVGDFGLLLGILGFFWITGSLEFRDLFQIANNWIPNNGINSLLTTLCAFLLFLGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLLARLLPLFISLPLIMSFISLVGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLITHAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYIPITRTTFLWGTLSLCGIPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTFGGYLRVHFQNYSSTKESSLYSISLWGKRIPKGVNRDFVLSTTKSGVSFFSQNIPKIQGNTRNRIGSFTTSFGAKNTFAYPHETGNTMLFPLLILLLFTLFIGFIGISFDNGGMDNGIAELTILSKWLTPSKNFTQESSNSFVNSYEFITNAISSVTLAIFGLFIAYIFYGSAYSFFQNLDLINSFVKRNPKKEFLDQVKKNIYSWSYNRGYIDIFYTRVFTLGIRGLTELTEFFDKGVIDGITNGVGLASFCIGEEIKYVGGGRISSYLFFFLCYVSVFLF

Entity 22 Entity 22 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic
Molecular weight formula_weight	19587.1 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MDLPGPIHEILMLFGEFILLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAVAQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTSLVCITFVFSLMTTIPDTSWYGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISIILLVSLIGAITMARQ

Entity 23 Entity 23 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic
Molecular weight formula_weight	44563.4 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MIVNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAITVNAPEFLENIQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGAQTPFFYIFRERELIYDLFEAATGMRMMHNYFRIGGVAADLPYGWIDKCLDFCDYFLRGVVEYQQLITQNPIFLERVEGVGFISGEEAVNWGLSGPMLRASGIQWDLRKVDPYESYNQFDWKVQWQKEGDSLARYLVRVGEMSESIKIIQQAIEKIPGGPYENLEVRRFKKEKNSEWNDFEYKFLGKKPSPNFELSRQELYVRVEAPKGELGIYLVGDDSLFPWRWKIRPPGFINLQILPQLVKKMKLADIMTILGSIDIIMGEVDR

Entity 24 Entity 24 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit I, chloroplastic
Molecular weight formula_weight	19271.1 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

PMVTGFMSYGQQTIRATRYIGQSFITTLSHTNRLPITIHYPYEKSITPERFRGRIHFEFDKCIACEVCVRVCPIDLPVVDWRFEKDIKRKQLLNYSIDFGVCIFCGNCVEYCPTSCLSMTEEYELSTYDRHELNYNQIALSRLPISIMGDYTIQTIRNSSESKIN

Entity 25 Entity 25 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit J, chloroplastic
Molecular weight formula_weight	18733.2 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

Entity 26 Entity 26 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit K, chloroplastic
Molecular weight formula_weight	27568.8 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MVLTEYLDKKKEGKDSIETVMNLIEFPLLDQTSSNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDALTKLRKKISREIVEDRTLSQNKKRCFTTSHKLYVRRSTHTGTYEQELLYQSPSTLDISSETFLKSKSPVPSYKLVN

Entity 27 Entity 27 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit L, chloroplastic
Molecular weight formula_weight	22240.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MEITASWRFLPVASSLPPALLLARRQASCPWSLQQPAISKSRILCRLHDKPFPTAQSSQLQKLASVLQCGAIWAAVQAPAALATVSGEEDIDILGILPPVAAIAFFYLFVAPPIIMNWMRLRWFKRKFIETYLQFMFTYLFFPGLMLWAPFVNFRKFPRDKTMKYPWSKPKEGTPLFKDRYPQIDSFKEKYF

Entity 28 Entity 28 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit M, chloroplastic
Molecular weight formula_weight	24051.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MATAAASSLLSPASKFALQSRRSSPKTAPRSVRFLPVRAQQQVKEEEPAATVPPPQEEGQATTAAAAKGPAQSLPRQPRAESKNMGREYGSQWLSCTTRHVRIYAAYIDPETNAFDQTQTDKLTLMLDPTEEFVWTDETCQMVYNEFQDLVDHYEGAPLSEYTLRLIGSDLEHYIRKLLYDGEIKYNMRSRVLNFSMGKPRVKFNSSQIPDVK

Entity 29 Entity 29 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit N, chloroplastic
Molecular weight formula_weight	25928.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MWSGAAAAVAARSVSPPLHAPTSLTGRRGAGRPSTVSVRAGGGLMDFVGGDLVKPDLGRWLDDVEKHKALAIYPPHEGGYEGRYLNRLRYQGYYFLDLSARGLGDPESTLTKIHPVCPPSLGRQPVARWYFPPEVDYRLSLLHPDAKGLIVWVYEAKVSFRLSLAALTLNFLIVFPCSFRLQVLSKAELQFLAMLPDLRPKVRVIAECGNWRKFIWKPLKQISGLEPDPDAEE

Entity 30 Entity 30 polymer

Description description	Unidentified stromal protein
Molecular weight formula_weight	5209.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 31 Entity 31 polymer

Description description	Photosynthetic NDH subunit of subcomplex L1
Molecular weight formula_weight	17835.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

NYRSYVDANDGYSYLYPADWRDFDFLGHDSAFKDRNVQLQSVRVAFIPTQKTDIRDLGPMDEAIFNLVNEVYAAPNQIPTIYEMQERTVDGRNYWTFEYDLEAPGYGVSAFATIAIGNGRYYTLIVTANERRWSRLRNKLKVVADSFKISDLNA

Entity 32 Entity 32 polymer

Description description	Photosynthetic NDH subunit of subcomplex L2
Molecular weight formula_weight	23946.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MATLVKHLILCSSTTTSSSATPSPSNRRPPSSPDGADKRAHLTQSSTRRLAVAASTAMVATAALSARRPAAPPPAMAAEAAAVRLPVPPGTVPRWGTRSYVRERFFEPGLTTEEAAARIRQTAEGMRTLRPMLETMSWKYVLFYVRLKSKYLDLDLTTAMAGVPEPRRPEYVLVANELVDNMTEFDRFVRTPKVYESYLYYEKTLKSLDDVAEFLG

Entity 33 Entity 33 polymer

Description description	Photosynthetic NDH subunit of subcomplex L2
Molecular weight formula_weight	24734.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MASTYLSSFQAAAAATSGGASTRPRPRPRPRVVTCHTSEPSGRRSACLSLGLGLATAAVLHTTPARAIADGDEEPEPANNGWWLTEFPLPVPKIRNKEINNGETGTRSFVKNGIYMADIGPSFAAHAYRVRSSAFDLLALEDLLGKEASNYVNKYLRLKATFIYYDFDKLITAADPDAKPPLLDLANRLFDSFEKLQAAVTTKDDTDIGSCYADTKLILQEVMTRMA

Entity 34 Entity 34 polymer

Description description	Photosynthetic NDH subunit of subcomplex L4
Molecular weight formula_weight	13954.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

ARAALELHRSLCPLLVSPRELEFLQVRDPSFCSVSMVVTQIHYTARFPDGTVFDSSYKRGRPLTMRIGAGKILRGLQQGIGGGGGVTPMLVGGKRKLMIPPILAYGPEPAGCFSEAVFAQAEMNFCALAA

Entity 35 Entity 35 polymer

Description description	Photosynthetic NDH subunit of subcomplex L5
Molecular weight formula_weight	25818.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MAAATSSFATLAVARPAAAAQRALLAAKAPSSALSLRGVGRVASPALSVSLQTRARFVASASAEPYAPELQSKVTNKVYFDINIGNPVGKNVGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHTGPGVLSMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGMDIVRMIESSETDRGDRPKKKVVISECGELPVV

Entity 36 Entity 36 polymer

Description description	Photosynthetic NDH subunit of subcomplex B1
Molecular weight formula_weight	51675.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MQTPTMPTPMAARPTSTMATKLPAPSATPRQCHLLPGRRVAGLARASSKKRNPWLDPFDDGPDEEFDYTGVYSGGKQEEDPRPPEDAENPYGFLRFPMGYMPELDSLASKVRGDVRRVCCVVSGGVYENVLFFPVVQMLKDRYPGVLVDVVASARGKQVYEMCKNVRYANVYDPDDEWPEPAEYTHQLGVMKNRYYDMVLSTKLAGTGHALFLFMSSAREKVGYVYPNVNGAGAGLFLTEMFKPATTNLADGGYNMYQDMLEWLGRPAKGVPQQPIPPLRVSISKKLRAVVEDKYNRAGVEKGKYVVIHGIESDSVANMKSRGDDDCLLPLELWAEIAKEISSGGNGLRPLFVMPHERHREEIEEIVGEETAYLFITTPGQLTCLINDSAGVVATNTAAVQLANARDKPCVALFSSKEKARLFLPYVEERKSCTVVASATGKLAGIDIEAVKKAVKDLEPAPSFALAQT

Entity 37 Entity 37 polymer

Description description	Photosynthetic NDH subunit of subcomplex B2
Molecular weight formula_weight	38080.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MAAASFLPLHLPASPRPATVAARAASGVASMVPAQASQLEEAFGRKGLRFGTDATGAPTAELSVRNGSSLQLRLNDGLVTSYRPKVSWEGGDGCRELLHTVVGAGAGAVRGGVGLVLNEAASSSSSSSPLLGASEWSVADVDSDSYDAVQVELGCVASKLEVSYVVTLYPLSMATAVIVKNNGARPVELTAAVLSHIKFDKRRGTAVEGLRGCPYCSHPPPASGFALLTPAEAMKREESGWFGGGGGEEPRQGAWTVEENLYTILKKKVSRVYAAPPEERKKRIYNTAPSKFTTIDQSSGLGFRLVRMGFEDMYLGSPGGMYDKFGNDYFLCTGPASILVPVVVGPGEEWRGAQVIEHDNL

Entity 38 Entity 38 polymer

Description description	Photosynthetic NDH subunit of subcomplex B3
Molecular weight formula_weight	13313.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

FAFVSPRLLPDGTPDVHYRTACGGQKLRDIMLDAYIDLYGPYDKLLLNCSGGGECGTCIVEVVEGGEMLSPKNEVEKEKLKRKPKSWRLACQATVGNPDSTGQMVIQQLPEWKVHKWDK

Entity 39 Entity 39 polymer

Description description	Photosynthetic NDH subunit of subcomplex B4
Molecular weight formula_weight	9756.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

NQRDWVVTKSIWHLSDTAIKSFYTFYAMFTVWGVCFFASMKASMADPFYDSEHYRGQGGDGTVHWYYDRQEDIEATARGDLLR

Entity 40 Entity 40 polymer

Description description	Photosynthetic NDH subunit of subcomplex B5
Molecular weight formula_weight	18146.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

GPLTEIEPDLQEDPIDKWRTNGVSPEDFVYGVYDGHHTYDEGQEKKGFWEDVSEWYQEAEPPQGFQALISWSFPPAVILGMAFDVPGEYLYIGAAIFIVVFCIIEMDKPDKPHNFEPEIYMMERSKRDKLIADYNSMDIWDFNEKYGELWDFTVN

Entity 41 Entity 41 polymer

Description description	Chlorophyll a-b binding protein Lhca4
Molecular weight formula_weight	21976.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

KGSWLPGLQSPAYLDGSLAGDNGFDPLALAEDPEDLRWFVQAELVNGRWAMLGVAGMLIPEVLTKAGLLNAPEWYDAGKETYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGSVFNPLNFAPTLENKEKELANGRLAMLAFLGFLVQHNVTGKGPFENLQQHLADPWHNTIIQTI

Entity 42 Entity 42 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23904.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

TVCEPLGPDRPVWFPGTAPPPWLDGSLPGDFGFDPLGFGSEPESLRWFAQAELMHGRWAMLAVAGILIPEILQKWGFMEEFSWYTAGEREYFADPWTLFVTQMALMGWVEGRRWMDYLNPGSVDIEPRFPNRKNPTPDVGYPGGLWFDWGNWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQVVYTGQGPLDNLFAHLADPGHCNIFSA

Entity 43 Entity 43 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 44 Entity 44 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	273

Entity 45 Entity 45 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 46 Entity 46 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 47 Entity 47 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	51

Entity 48 Entity 48 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 49 Entity 49 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 50 Entity 50 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 51 Entity 51 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 52 Entity 52 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	23

Entity 53 Entity 53 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 54 Entity 54 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	103844

PSI-NDH supercomplex of Barley

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VI, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit psaK, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer