SAXSdb — 7i0a

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Streptogramin A acetyltransferase

Enterococcus faecium

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	6-bromanyl-1,3-benzothiazol-2-amine × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VATD_ENTFC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–209； UniProt 2–209 Author chain B； PDBConstruct 2–209； UniProt 2–209 Author chain C； PDBConstruct 2–209； UniProt 2–209

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7i0a
Deposition date deposition_date	2025-01-25
Last revision last_revision	2026-01-28
Structure title title	PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000004774482
Keywords keywords	VatD, antibiotic resistance, streptogramin, fragment-based drug discovery, TRANSFERASE; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7i0a__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7i0a__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7i0a__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.03 Å
Rg (electron density)	26.90 Å
Total Rg	27.65 Å
Atom count	9636
Residues	608
Excluded volume	86610 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7i0a__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Streptogramin A acetyltransferase
Molecular weight formula_weight	23601.2 kDa
EC 编号 ec_number	2.3.1.-
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	9825

GGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIKWWNWPIDIINENIDKILDNSIIREVIWKK

Source Source

Source organism organism	Enterococcus faecium
NCBI taxonomy ID ncbi_taxonomy_id	1352
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	6-bromanyl-1,3-benzothiazol-2-amine
Molecular weight formula_weight	229.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	34

▶

Unit-cell length a length_a	43.970 Å
Unit-cell length b length_b	101.637 Å
Unit-cell length c length_c	146.684 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.150 Å
Low-resolution limit resolution_low	48.020 Å
R factor r_factor	0.2489
R_work r_work	0.2457
R_free r_free	0.3054

PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000004774482

1. Protein Identity and Related Structures Protein Identity & Related Structures

Streptogramin A acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7i0a__assembly_1__model_1

7i0a__assembly_1__model_1 | I(q)

7i0a__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000004774482

1. Protein Identity and Related Structures Protein Identity & Related Structures

Streptogramin A acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7i0a__assembly_1__model_1

7i0a__assembly_1__model_1 | I(q)

7i0a__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)