SAXSdb — 7lfc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Importin subunit alpha-3

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–521	Not recorded	Nuclear factor NF-kappa-B p105 subunit × 1 （P19838）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2M potassium thiocyanate, 20% PEG3350, 0.1 M BIS-TRIS pH 6.5	Resolution 2.10 Å R-free 0.220

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7LFC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4UAE Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain Deposited 2014-08-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 68–487（420 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.1 M Na cacodylate, pH 6.5 0.1 M NaCl 1.1 M ammonium sulfate	Resolution 2.70 Å R-free 0.239
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5XZX Crystal structure of importin-alpha3 bound to the nuclear localization signal of Ran-binding protein 3 Deposited 2017-07-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 70–485（416 aa） Fragment：UNP residues 70-485	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG 8000	Resolution 3.00 Å R-free 0.281
6BVV Nipah virus W protein C-terminus in complex with Importin alpha 3 Deposited 2017-12-13	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M lithium nitrate, 20% w/v PEG3350	Resolution 2.30 Å R-free 0.222
6BVZ Importin alpha 3 in cargo free state Deposited 2017-12-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.2 M sodium nitrate, 0.1 M bis-tris propane pH 6.5, 25% w/v PEG3350	Resolution 2.30 Å R-free 0.269
6BW9 Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1 Deposited 2017-12-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M sodium citrate pH 5.0, 20% w/v PEG 2000	Resolution 1.60 Å R-free 0.196
6BWA Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2 Deposited 2017-12-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.2M sodium chloride, 0.1M MES pH6.5, 10% w/v PEG 4000	Resolution 2.20 Å R-free 0.215
6BWB Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3 Deposited 2017-12-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.2M sodium chloride, 0.1M MES pH6.5, 10% w/v PEG 4000	Resolution 2.30 Å R-free 0.218
6WX8 SOX2 bound to Importin-alpha 3 Deposited 2020-05-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；1.2M (NH4)2SO4, 0.1M HEPES pH 6.5	Resolution 2.30 Å R-free 0.245
6WX8 SOX2 bound to Importin-alpha 3 Deposited 2020-05-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 64–521（458 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；1.2M (NH4)2SO4, 0.1M HEPES pH 6.5	Resolution 2.30 Å R-free 0.245
7JJL Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS Deposited 2020-07-27	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.7 M sodium citrate, 0.01M DTT, 0.1M sodium HEPES pH 7	Resolution 2.60 Å R-free 0.266
7LF4 Structure of importin a3 bound to the p50- and p65-NLSs Deposited 2021-01-15	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M ammonium sulfate, 0.1 M BIS-TRIS pH 6.5, 25% PEG 3350	Resolution 2.85 Å R-free 0.238
7LF4 Structure of importin a3 bound to the p50- and p65-NLSs Deposited 2021-01-15	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M ammonium sulfate, 0.1 M BIS-TRIS pH 6.5, 25% PEG 3350	Resolution 2.85 Å R-free 0.238
7RFY Importin alpha3 in complex with MERS ORF4B Deposited 2021-07-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；0.2 M magnesium chloride, 0.1 M Tris pH 8.0, 20% w/v PEG 6000	Resolution 2.50 Å R-free 0.267
7RG5 Importin alpha3 in complex with p50 NLS Deposited 2021-07-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；0.2M potassium thiocyanate and 20% PEG3350	Resolution 2.15 Å R-free 0.262
8FUB Crystal structure of human Importin alpha 3 in complex with Hendra virus matrix protein NLS1 Deposited 2023-01-17	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1M sodium HEPES,0.72M sodium citrate, 1% dithiothreitol	Resolution 2.75 Å R-free 0.281
8FZM Human importin alpha 3 in complex with Bimax2 peptide Deposited 2023-01-29	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1M sodium HEPES, 0.78M sodium citrate, 1% Dithiothreitol	Resolution 3.00 Å R-free 0.260
8FZM Human importin alpha 3 in complex with Bimax2 peptide Deposited 2023-01-29	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1M sodium HEPES, 0.78M sodium citrate, 1% Dithiothreitol	Resolution 3.00 Å R-free 0.260
8HKW Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal Deposited 2022-11-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 70–485（416 aa） Fragment：UNP residues 70-485 Chain B 70–485（416 aa） Fragment：UNP residues 70-485	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Mother liquor contained PEG3350 and lithium nitrate. Crystal was grown in the presence of a synthetic peptide (amino acid sequence: GTSFSGRKIKTAVRRRK) that corresponds to human Nup153 residues 1459-1475).	Resolution 1.90 Å R-free 0.221

16 other PDB entries and 26 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IMA3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–521； UniProt 1–521

Nuclear factor NF-kappa-B p105 subunit

OrganismNot specified

UniProt P19838

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 355–368	Fragment：Nuclear localization signal motif, residues 355-368	Importin subunit alpha-3 × 1 （O00629）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2M potassium thiocyanate, 20% PEG3350, 0.1 M BIS-TRIS pH 6.5	Resolution 2.10 Å R-free 0.220

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7LFC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1MDI HIGH RESOLUTION SOLUTION NMR STRUCTURE OF MIXED DISULFIDE INTERMEDIATE BETWEEN MUTANT HUMAN THIOREDOXIN AND A 13 RESIDUE PEPTIDE COMPRISING ITS TARGET SITE IN HUMAN NFKB Deposited 1995-02-27	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 53–65（13 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1MDJ HIGH RESOLUTION SOLUTION NMR STRUCTURE OF MIXED DISULFIDE INTERMEDIATE BETWEEN HUMAN THIOREDOXIN (C35A, C62A, C69A, C73A) MUTANT AND A 13 RESIDUE PEPTIDE COMPRISING ITS TARGET SITE IN HUMAN NFKB (RESIDUES 56-68 OF THE P50 SUBUNIT OF NFKB) Deposited 1995-02-27	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 53–65（13 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1MDK HIGH RESOLUTION SOLUTION NMR STRUCTURE OF MIXED DISULFIDE INTERMEDIATE BETWEEN HUMAN THIOREDOXIN (C35A, C62A, C69A, C73A) MUTANT AND A 13 RESIDUE PEPTIDE COMPRISING ITS TARGET SITE IN HUMAN NFKB (RESIDUES 56-68 OF THE P50 SUBUNIT OF NFKB) Deposited 1995-02-27	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 53–65（13 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1NFI I-KAPPA-B-ALPHA/NF-KAPPA-B COMPLEX Deposited 1998-08-25	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 248–354（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5；pH 5.0	Resolution 2.70 Å R-free 0.265
1NFI I-KAPPA-B-ALPHA/NF-KAPPA-B COMPLEX Deposited 1998-08-25	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 248–354（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5；pH 5.0	Resolution 2.70 Å R-free 0.265
1SVC NFKB P50 HOMODIMER BOUND TO DNA Deposited 1995-11-27	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain P 2–366（365 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；VAPOR DIFFUSION, HANGING DROP	Resolution 2.60 Å R-free 0.286
2DBF Solution structure of the Death domain in human Nuclear factor NF-kappa-B p105 subunit Deposited 2005-12-15	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 806–893（88 aa） Fragment：DEATH DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120mM；Pressure AMBIENT NMR sample composition 1mM protein; 20mM d-tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2O61 Crystal Structure of NFkB, IRF7, IRF3 bound to the interferon-b enhancer Deposited 2006-12-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 40–352（313 aa） Fragment：RHR region	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；100 mM HEPES, pH 7.0, 15% (w/v) PEG 4000, VAPOR DIFFUSION, HANGING DROP, temperature 294K	Resolution 2.80 Å R-free 0.278
3GUT Crystal structure of a higher-order complex of p50:RelA bound to the HIV-1 LTR Deposited 2009-03-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 41–352（312 aa） Fragment：UNP residues 41-352 Chain D 41–352（312 aa） Fragment：UNP residues 41-352	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；289 K；50mM BTP pH 6.3, 50mM CaCl2, 7% w/v PEG 3000, 1mM Spermine, 10mM DTT, 8% v/v Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 3.59 Å R-free 0.301
3GUT Crystal structure of a higher-order complex of p50:RelA bound to the HIV-1 LTR Deposited 2009-03-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain F 41–352（312 aa） Fragment：UNP residues 41-352 Chain H 41–352（312 aa） Fragment：UNP residues 41-352	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；289 K；50mM BTP pH 6.3, 50mM CaCl2, 7% w/v PEG 3000, 1mM Spermine, 10mM DTT, 8% v/v Glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 3.59 Å R-free 0.301
7LEQ Structure of importin a2 bound to p50 NLS Deposited 2021-01-14	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 355–368（14 aa） Fragment：Nuclear localization signal motif, residues 355-368	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.6M sodium citrate, 100 Hepes pH 6.0	Resolution 2.24 Å R-free 0.219
7LET Structure of importin a2 bound to the p50- and p65-NLSs Deposited 2021-01-15	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 355–368（14 aa） Fragment：Nuclear localization signal motif, residues 355-368	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；0.6 Na Citrate, 100 mM HEPES pH 6	Resolution 2.40 Å R-free 0.241
7LF4 Structure of importin a3 bound to the p50- and p65-NLSs Deposited 2021-01-15	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 355–368（14 aa） Fragment：Nuclear localization signal motif, residues 355-368	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M ammonium sulfate, 0.1 M BIS-TRIS pH 6.5, 25% PEG 3350	Resolution 2.85 Å R-free 0.238
7LF4 Structure of importin a3 bound to the p50- and p65-NLSs Deposited 2021-01-15	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 355–368（14 aa） Fragment：Nuclear localization signal motif, residues 355-368	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M ammonium sulfate, 0.1 M BIS-TRIS pH 6.5, 25% PEG 3350	Resolution 2.85 Å R-free 0.238
7RG4 Importin alpha2 in complex with p50 NLS Deposited 2021-07-14	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 151–190（40 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；0.7 M sodium citrate, 0.01M DTT, 0.1M sodium HEPES pH 7	Resolution 2.60 Å R-free 0.243
8TQD NF-Kappa-B1 Bound with a Covalent Inhibitor Deposited 2023-08-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–245（206 aa）	Not recorded	JMR 1-(2-bromo-4-chlorophenyl)-N-{(3S)-1-[(E)-iminomethyl]pyrrolidin-3-yl}methanesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M Citrate pH5.0, 20%w/v PEG 6000	Resolution 2.02 Å R-free 0.227

13 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NFKB1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–14； UniProt 355–368

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7lfc
Deposition date deposition_date	2021-01-16
Structure title title	Structure of importin a3 bound to p50 NLS
Keywords keywords	NUCLEAR IMPORT, IMPORTIN ALPHA 3, NLS, NF-kB, p50, p65, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	28.12 Å
Radius of gyration Rg (electron density) rg_electron	27.69 Å
Forward intensity I(0) i0	34446800.00
Molecular weight molecular_weight	46433.0 kDa
Excluded volume excluded_volume	58498 Å³
Envelope volume envelope_volume	71545 Å³
Hydration-shell volume shell_volume	23226 Å³
Envelope diameter envelope_diameter	102.6 Å
Shell Rg shell_rg	32.81 Å
Envelope Rg envelope_rg	27.83 Å
Shape Rg shape_rg	27.70 Å
Total Rg total_rg	28.22 Å
Total atoms total_atoms	3266
Residues n_residues	426
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	98.8 Å
Rg (real space) rg_real	28.49 Å
Rg uncertainty (real space) rg_real_error	0.93 Å
I(0) (real space) i0_real	3.4450e+07
I(0) uncertainty (real space) i0_real_error	5.4090e+05
Rg (reciprocal space) rg_reciprocal	28.38 Å
I(0) (reciprocal space) i0_reciprocal	34440000.0000
Solution quality estimate total_estimate	0.6181
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	22.9 Å
Skewness Skewness skewness	0.548
Kurtosis Kurtosis kurtosis	-0.371
Angular range angular_range	— – 0.2800 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	11820000.0000
Real-space data points n_real_points	57
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.625; Stabil: 0.999; Sysdev: 0.242; Positv: 1.000; Valcen: 0.505; Smooth: 0.927

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Importin subunit alpha-3
Molecular weight formula_weight	57941.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3371

MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Nuclear factor NF-kappa-B p105 subunit
Molecular weight formula_weight	1790.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

DKEEVQRKRQKLMP

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	105

▶

8. Citations (1)

▶

Unit-cell length a length_a	47.650 Å
Unit-cell length b length_b	59.070 Å
Unit-cell length c length_c	86.090 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	96.34 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	14.930 Å
R factor r_factor	0.1887
R_work r_work	0.1871
R_free r_free	0.2203

fit	/app/data/saxs_computation/lf/7lfc/7lfc.fit
pddf	/app/data/pr_computation/lf/7lfc/7lfc.pr.out
profile	/app/data/saxs_computation/lf/7lfc/7lfc.dat

Structure of importin a3 bound to p50 NLS

1. Protein Identity and Related Structures Protein Identity & Related Structures

Importin subunit alpha-3

State in the Current Structure

Other States of the Same Protein in the Database

Nuclear factor NF-kappa-B p105 subunit

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)