7nyn

Mutant Y526A of SH3 domain of JNK-interacting Protein 1 (JIP1)

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SH3 domain of JNK-interacting Protein 1 (JIP1)

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	PHOSPHATE ION × 1 PENTAETHYLENE GLYCOL × 3 1,2-ETHANEDIOL × 1 TETRAETHYLENE GLYCOL × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	PENTAETHYLENE GLYCOL × 2 1,2-ETHANEDIOL × 2 TETRAETHYLENE GLYCOL × 2 SULFATE ION × 2 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	PENTAETHYLENE GLYCOL × 1 1,2-ETHANEDIOL × 1 SULFATE ION × 1 water × 2	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	PHOSPHATE ION × 2 PENTAETHYLENE GLYCOL × 2 1,2-ETHANEDIOL × 1 TETRAETHYLENE GLYCOL × 1 SULFATE ION × 1 DI(HYDROXYETHYL)ETHER × 1 water × 2	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 2	TETRAETHYLENE GLYCOL × 1 SULFATE ION × 1 DI(HYDROXYETHYL)ETHER × 1 water × 2	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 2	1,2-ETHANEDIOL × 2 SULFATE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	JIP1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AAA； PDBConstruct 4–63； UniProt 490–549 Author chain BBB； PDBConstruct 4–63； UniProt 490–549 Author chain CCC； PDBConstruct 4–63； UniProt 490–549 Author chain DDD； PDBConstruct 4–63； UniProt 490–549 Author chain EEE； PDBConstruct 4–63； UniProt 490–549 Author chain FFF； PDBConstruct 4–63； UniProt 490–549 Author chain GGG； PDBConstruct 4–63； UniProt 490–549 Author chain HHH； PDBConstruct 4–63； UniProt 490–549 Author chain III； PDBConstruct 4–63； UniProt 490–549 Author chain JJJ； PDBConstruct 4–63； UniProt 490–549 Author chain KKK； PDBConstruct 4–63； UniProt 490–549 Author chain LLL； PDBConstruct 4–63； UniProt 490–549

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7nyn
Deposition date deposition_date	2021-03-23
Structure title title	Mutant Y526A of SH3 domain of JNK-interacting Protein 1 (JIP1)
Keywords keywords	SH3 domain of JNK-interacting protein 1 (JIP1), SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7nyn__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7nyn__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7nyn__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.95 Å
Rg (electron density)	14.63 Å
Total Rg	15.97 Å
Atom count	1082
Residues	121
Excluded volume	19118 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7nyn__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7nyn__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`7nyn__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`7nyn__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`7nyn__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`7nyn__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	SH3 domain of JNK-interacting Protein 1 (JIP1)
Molecular weight formula_weight	7434.3 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AAA,BBB,CCC,DDD,EEE,FFF,GGG,HHH,III,JJJ,KKK,LLL
Atom count atom_count	7091

GHMEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWAEAYNMRTGARGVFPAYYAIEVTK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	PENTAETHYLENE GLYCOL
Molecular weight formula_weight	238.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 5 Entity 5 non-polymer

Description description	TETRAETHYLENE GLYCOL
Molecular weight formula_weight	194.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 6 Entity 6 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	700

▶

Unit-cell length a length_a	210.639 Å
Unit-cell length b length_b	62.485 Å
Unit-cell length c length_c	87.056 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	1.537 Å
Low-resolution limit resolution_low	49.350 Å
R factor r_factor	—
R_work r_work	0.1378
R_free r_free	0.1796

Mutant Y526A of SH3 domain of JNK-interacting Protein 1 (JIP1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

SH3 domain of JNK-interacting Protein 1 (JIP1)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7nyn__assembly_2__model_1

7nyn__assembly_2__model_1 | I(q)

7nyn__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)

Mutant Y526A of SH3 domain of JNK-interacting Protein 1 (JIP1)

1. Protein Identity and Related Structures Protein Identity & Related Structures

SH3 domain of JNK-interacting Protein 1 (JIP1)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7nyn__assembly_2__model_1

7nyn__assembly_2__model_1 | I(q)

7nyn__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)