SAXSdb — 7opo

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribosomal protein S6 kinase alpha-3

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 39–351	Not recorded	Protein ORF45 × 1 （F5HDE4） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 39–351	Not recorded	Protein ORF45 × 1 （F5HDE4） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 39–351	Not recorded	Protein ORF45 × 1 （F5HDE4） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain G； UniProt 39–351	Not recorded	Protein ORF45 × 1 （F5HDE4） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain I； UniProt 39–351	Not recorded	Protein ORF45 × 1 （F5HDE4） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain K； UniProt 39–351	Not recorded	Protein ORF45 × 1 （F5HDE4） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7OPO	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4D9T Rsk2 C-terminal Kinase Domain with inhibitor (E)-methyl 3-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H-pyrrolo[2,3-d]pyrimidin-6-yl)-2-cyanoacrylate Deposited 2012-01-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 399–740（342 aa） Fragment：C-terminal kinase domain, UNP residues 399-740	Not recorded	0JG methyl (2S)-3-{4-amino-7-[(1E)-3-hydroxyprop-1-en-1-yl]-5-(4-methylphenyl)-7H-pyrrolo[2,3-d]pyrimidin-6-yl}-2-cyanopropanoate × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 8.5；298 K；100mM Tris, pH 8.5, 25% PEG 3350, hanging drop, temperature 298K	Resolution 2.40 Å R-free 0.267
4D9T Rsk2 C-terminal Kinase Domain with inhibitor (E)-methyl 3-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H-pyrrolo[2,3-d]pyrimidin-6-yl)-2-cyanoacrylate Deposited 2012-01-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 399–740（342 aa） Fragment：C-terminal kinase domain, UNP residues 399-740	Not recorded	0JG methyl (2S)-3-{4-amino-7-[(1E)-3-hydroxyprop-1-en-1-yl]-5-(4-methylphenyl)-7H-pyrrolo[2,3-d]pyrimidin-6-yl}-2-cyanopropanoate × 2 NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 8.5；298 K；100mM Tris, pH 8.5, 25% PEG 3350, hanging drop, temperature 298K	Resolution 2.40 Å R-free 0.267
4D9U Rsk2 C-terminal Kinase Domain, (E)-tert-butyl 3-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H-pyrrolo[2,3-d]pyrimidin-6-yl)-2-cyanoacrylate Deposited 2012-01-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 399–740（342 aa） Fragment：UNP residues 399-740	Not recorded	0JH tert-butyl (2S)-3-[4-amino-7-(3-hydroxypropyl)-5-(4-methylphenyl)-7H-pyrrolo[2,3-d]pyrimidin-6-yl]-2-cyanopropanoate × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 8.5；298 K；100mM Tris, pH 8.5, 25% PEG 3350, hanging drop, temperature 298K	Resolution 2.40 Å R-free 0.276
4D9U Rsk2 C-terminal Kinase Domain, (E)-tert-butyl 3-(4-amino-7-(3-hydroxypropyl)-5-p-tolyl-7H-pyrrolo[2,3-d]pyrimidin-6-yl)-2-cyanoacrylate Deposited 2012-01-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 399–740（342 aa） Fragment：UNP residues 399-740	Not recorded	0JH tert-butyl (2S)-3-[4-amino-7-(3-hydroxypropyl)-5-(4-methylphenyl)-7H-pyrrolo[2,3-d]pyrimidin-6-yl]-2-cyanopropanoate × 2 NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 8.5；298 K；100mM Tris, pH 8.5, 25% PEG 3350, hanging drop, temperature 298K	Resolution 2.40 Å R-free 0.276
4JG6 RSK2 CTD bound to 2-cyano-3-(1H-indazol-5-yl)acrylamide Deposited 2013-02-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 399–740（342 aa）	Not recorded	1LB (2S)-2-cyano-3-(1H-indazol-5-yl)propanamide × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；100 mM HEPES, 50 mM Ammonium Sulfate, 7.5% PEG 3350, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.60 Å R-free 0.299
4JG7 Structure of RSK2 CTD bound to 3-(3-(1H-pyrrolo[2,3-b]pyridine-3-carbonyl)phenyl)-2-cyanoacrylamide Deposited 2013-02-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 399–740（342 aa）	Not recorded	1LC (2R)-2-cyano-3-[3-(1H-pyrrolo[2,3-b]pyridin-3-ylcarbonyl)phenyl]propanamide × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；100 mM HEPES, 50 mM Ammonium Sulfate, 7.5% PEG3350, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.00 Å R-free 0.298
4JG8 Structure of RSK2 T493M CTD mutant bound to 2-cyano-N-(1-hydroxy-2-methylpropan-2-yl)-3-(3-(3,4,5-trimethoxyphenyl)-1H-indazol-5-yl)acrylamide Deposited 2013-02-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 399–740（342 aa）	Mutation：T493M	1LE (2S)-2-cyano-N-(1-hydroxy-2-methylpropan-2-yl)-3-[3-(3,4,5-trimethoxyphenyl)-1H-indazol-5-yl]propanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；100 mM HEPES, 50 mM Ammonium Sulfate, 7.5% PEG 3350, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.10 Å R-free 0.298
4NUS Rsk2 N-terminal kinase in complex with LJH685 Deposited 2013-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–359（321 aa） Fragment：N-terminal domain (UNP residues 39-359)	Not recorded	2NK 2,6-difluoro-4-{4-[4-(4-methylpiperazin-1-yl)phenyl]pyridin-3-yl}phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；12-24% PEG3350, 100 mM sodium malonate pH 5-7, microseeding, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.39 Å R-free 0.231
4NW5 Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 8 Deposited 2013-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–359（321 aa） Fragment：N-terminal domain (UNP residues 39-359)	Not recorded	2NR 7-(2-fluoro-6-methoxyphenyl)-N-(3,4,5-trimethoxyphenyl)-1,3-benzoxazol-2-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；7-8 mg/mL protein mixed 1:1:0.5 with 12-24% PEG3350 plus 100 mM sodium malonate pH 5-7 and microseeds, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.94 Å R-free 0.219
4NW6 Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 27 Deposited 2013-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–359（321 aa） Fragment：N-terminal domail (UNP residues 39-359)	Not recorded	2NS 7-(1H-benzimidazol-7-yl)-N-(3,4,5-trimethoxyphenyl)-1,3-benzoxazol-2-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；7-8 mg/mL protein mixed 1:1:0.5 with 12-24% PEG3350 plus 100 mM sodium malonate pH 5-7 and microseeds, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.74 Å R-free 0.201
5D9K Rsk2 N-terminal Kinase in Complex with BI-D1870 Deposited 2015-08-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–366（328 aa） Fragment：N-terminal kinase (UNP residues 39-366)	Not recorded	584 (7R)-2-[(3,5-difluoro-4-hydroxyphenyl)amino]-5,7-dimethyl-8-(3-methylbutyl)-7,8-dihydropteridin-6(5H)-one × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；20% PEG3350, 0.075 M lithium citrate	Resolution 2.55 Å R-free 0.227
5D9K Rsk2 N-terminal Kinase in Complex with BI-D1870 Deposited 2015-08-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 39–366（328 aa） Fragment：N-terminal kinase (UNP residues 39-366)	Not recorded	584 (7R)-2-[(3,5-difluoro-4-hydroxyphenyl)amino]-5,7-dimethyl-8-(3-methylbutyl)-7,8-dihydropteridin-6(5H)-one × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；20% PEG3350, 0.075 M lithium citrate	Resolution 2.55 Å R-free 0.227
5D9L Rsk2 N-terminal Kinase in Complex with bis-phenol pyrazole Deposited 2015-08-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–359（321 aa） Fragment：N-terminal kinase (UNP residues 39-359)	Not recorded	583 4,4'-(1H-pyrazole-3,4-diyl)diphenol × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291 K；20% PEG3350, 0.2 M lithium citrate	Resolution 2.15 Å R-free 0.224
8EQ5 Crystal structure of the N-terminal kinase domain of RSK2 in complex with SPRED2 (131-160) Deposited 2022-10-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 46–346（301 aa）	Not recorded	QCT 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-3-yl 6-deoxy-alpha-L-mannopyranoside × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；30% w/v PEG 2K MME, 0.1 M Tris, pH 8.0	Resolution 1.80 Å R-free 0.225
8R58 The RSK 2 N-terminal kinase domain in complex with BMF (1-19) Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 39–351（313 aa）	Not recorded	QCT 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-3-yl 6-deoxy-alpha-L-mannopyranoside × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；25% PEG 550, 0,1M Tris pH 8.5, 10% isopropanol, 1.25 M NaCl as reservoir	Resolution 2.31 Å R-free 0.263
8XEY The Crystal Structure of C-terminal kinase domain of RSK2 from Biortus Deposited 2023-12-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 400–740（341 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M Tris pH8.5, 25%PEG3,350	Resolution 2.65 Å R-free 0.280
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain J 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain G 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain H 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303
8XFY The Crystal Structure of RSK2 from Biortus. Deposited 2023-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain I 40–359（320 aa）	Not recorded	A1LU8 2,6-bis(fluoranyl)-4-[4-(4-morpholin-4-ylphenyl)pyridin-3-yl]phenol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1M sodium malonate pH6.75, 18% PEG 3350	Resolution 3.20 Å R-free 0.303

14 other PDB entries and 26 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KS6A3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–317； UniProt 39–351 Author chain C； PDBConstruct 5–317； UniProt 39–351 Author chain E； PDBConstruct 5–317； UniProt 39–351 Author chain G； PDBConstruct 5–317； UniProt 39–351 Author chain I； PDBConstruct 5–317； UniProt 39–351 Author chain K； PDBConstruct 5–317； UniProt 39–351

Protein ORF45

Human herpesvirus 8

UniProt F5HDE4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 16–76	Not recorded	Ribosomal protein S6 kinase alpha-3 × 1 （P51812） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 16–76	Not recorded	Ribosomal protein S6 kinase alpha-3 × 1 （P51812） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain F； UniProt 16–76	Not recorded	Ribosomal protein S6 kinase alpha-3 × 1 （P51812） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain H； UniProt 16–76	Not recorded	Ribosomal protein S6 kinase alpha-3 × 1 （P51812） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain J； UniProt 16–76	Not recorded	Ribosomal protein S6 kinase alpha-3 × 1 （P51812） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain L； UniProt 16–76	Not recorded	Ribosomal protein S6 kinase alpha-3 × 1 （P51812） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；12 %PEG 6000, HEPES pH 7.5, 0.75M NaCl in reservoir	Resolution 2.75 Å R-free 0.232

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7OPO	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7OPM Phosphorylated ERK2 in complex with ORF45 Deposited 2021-06-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 27–40（14 aa）	Not recorded	08G 1-[4-(hydroxymethyl)-1H-pyrazolo[4,3-c]pyridin-6-yl]-3-[(1S)-1-phenylethyl]urea × 1 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；293 K；0.1M Tris pH 8.3, 20% PEG 8000 with 1.25 M NaCl in reservoir	Resolution 2.45 Å R-free 0.254

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ORF45_HHV8P
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 3–63； UniProt 16–76 Author chain D； PDBConstruct 3–63； UniProt 16–76 Author chain F； PDBConstruct 3–63； UniProt 16–76 Author chain H； PDBConstruct 3–63； UniProt 16–76 Author chain J； PDBConstruct 3–63； UniProt 16–76 Author chain L； PDBConstruct 3–63； UniProt 16–76

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7opo
Deposition date deposition_date	2021-06-01
Structure title title	RSK2 N-terminal kinase domain in complex with ORF45
Keywords keywords	;ORF45, RSK2, RSK, RSK2 NTK, Viral modulation, MAPKAPK, Kaposi's sarcoma-associated herpesvirus, Viral protein, VF-motif ;; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	42.55 Å
Radius of gyration Rg (electron density) rg_electron	41.86 Å
Forward intensity I(0) i0	747534000.00
Molecular weight molecular_weight	232690.0 kDa
Excluded volume excluded_volume	294280 Å³
Envelope volume envelope_volume	384110 Å³
Hydration-shell volume shell_volume	74817 Å³
Envelope diameter envelope_diameter	143.1 Å
Shell Rg shell_rg	48.58 Å
Envelope Rg envelope_rg	41.06 Å
Shape Rg shape_rg	41.87 Å
Total Rg total_rg	42.19 Å
Total atoms total_atoms	16411
Residues n_residues	2046
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	137.3 Å
Rg (real space) rg_real	42.45 Å
Rg uncertainty (real space) rg_real_error	0.98 Å
I(0) (real space) i0_real	7.4750e+08
I(0) uncertainty (real space) i0_real_error	1.1750e+07
Rg (reciprocal space) rg_reciprocal	42.55 Å
I(0) (reciprocal space) i0_reciprocal	747600000.0000
Solution quality estimate total_estimate	0.8939
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	51.9 Å
Skewness Skewness skewness	0.244
Kurtosis Kurtosis kurtosis	-0.491
Angular range angular_range	— – 0.1850 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	154200000.0000
Real-space data points n_real_points	38
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.903; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.994; Smooth: 0.913

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Ribosomal protein S6 kinase alpha-3
Molecular weight formula_weight	36338.1 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K
Atom count atom_count	16458

GSASNPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRP

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Protein ORF45
Molecular weight formula_weight	6692.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L

GSRMLPIEGAPRRRPPVKFIFPPPPLSSLPGFGRPRGYAGPTVIDMSAPDDVFAEDTPSPPAT

来源 Source

来源生物 organism	Human herpesvirus 8
通用名 common_name	;HHV-8, Kaposi's sarcoma-associated herpesvirus ;
NCBI Class编号 ncbi_taxonomy_id	868565
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	506.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	47

▼

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	7opoA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	510 — Transferase(Phosphotransferase); domain 1
Homologous superfamily homologous superfamily	10 — Transferase(Phosphotransferase) domain 1

Domain ID domain_id	7opoC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	510 — Transferase(Phosphotransferase); domain 1
Homologous superfamily homologous superfamily	10 — Transferase(Phosphotransferase) domain 1

Domain ID domain_id	7opoE01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	510 — Transferase(Phosphotransferase); domain 1
Homologous superfamily homologous superfamily	10 — Transferase(Phosphotransferase) domain 1

Domain ID domain_id	7opoG01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	510 — Transferase(Phosphotransferase); domain 1
Homologous superfamily homologous superfamily	10 — Transferase(Phosphotransferase) domain 1

Domain ID domain_id	7opoI01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	510 — Transferase(Phosphotransferase); domain 1
Homologous superfamily homologous superfamily	10 — Transferase(Phosphotransferase) domain 1

Domain ID domain_id	7opoK01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	510 — Transferase(Phosphotransferase); domain 1
Homologous superfamily homologous superfamily	10 — Transferase(Phosphotransferase) domain 1

▶

8. Citations (1)

▶

Unit-cell length a length_a	170.290 Å
Unit-cell length b length_b	88.621 Å
Unit-cell length c length_c	160.346 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.42 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	monoclinic

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	47.650 Å
R factor r_factor	0.2094
R_work r_work	0.2087
R_free r_free	0.2322

fit	/app/data/saxs_computation/op/7opo/7opo.fit
pddf	/app/data/pr_computation/op/7opo/7opo.pr.out
profile	/app/data/saxs_computation/op/7opo/7opo.dat

RSK2 N-terminal kinase domain in complex with ORF45

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribosomal protein S6 kinase alpha-3

State in the Current Structure

Other States of the Same Protein in the Database

Protein ORF45

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)