SAXSdb — 7q8a

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poly(U)-binding-splicing factor PUF60

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Monomer Protein × 1 DNA 1 PDB declaration: dimeric（2） Consistent with all polymer counts	Chain A； UniProt 114–310	Not recorded	ssDNA × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；293 K；25% w/v PEG3350, 0.2M Sodium acetate trihydrate, 0.1M Bis-Tris , pH5.5	Resolution 2.05 Å R-free 0.247
2	Protein–DNA Monomer Protein × 1 DNA 1 PDB declaration: dimeric（2） Consistent with all polymer counts	Chain B； UniProt 114–310	Not recorded	;DNA (5'-D(PGPT)-3') ; × 1 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；293 K；25% w/v PEG3350, 0.2M Sodium acetate trihydrate, 0.1M Bis-Tris , pH5.5	Resolution 2.05 Å R-free 0.247

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7Q8A	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2KXF Solution structure of the first two RRM domains of FBP-interacting repressor (FIR) Deposited 2010-05-04	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 119–314（196 aa） Fragment：UNP residues 119-314	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 8；310 K；Ionic strength (raw mmCIF value) 0.06；Pressure ambient NMR sample composition 0.3-0.4 mM [U-15N] entity-1, 10 mM TRIS-HCl pH 8.0-2, 50 mM sodium chloride-3, 2 mM TCEP-4, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.3-0.4 mM [U-13C; U-15N] entity-5, 10 mM TRIS-HCl pH 8.0-6, 50 mM sodium chloride-7, 2 mM TCEP-8, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.3-0.4 mM [U-13C; U-15N; U70%-2H] entity-9, 10 mM TRIS-HCl pH 8.0-10, 50 mM sodium chloride-11, 2 mM TCEP-12, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KXH Solution structure of the first two RRM domains of FIR in the complex with FBP Nbox peptide Deposited 2010-05-05	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 119–314（196 aa） Fragment：UNP residues 119-314	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 8；310 K；Ionic strength (raw mmCIF value) 0.06；Pressure ambient NMR measurement conditions pH 8；318 K；Ionic strength (raw mmCIF value) 0.06；Pressure ambient NMR sample composition 0.6 mM [U-15N] protein_1-1, 10 mM TRIS-HCl pH 8.0-2, 50 mM sodium chloride-3, 2 mM TCEP-4, 1.25 mM protein_2-5, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition mM [U-13C; U-15N] protein_1-6, 10 mM TRIS-HCl pH 8.0-7, 50 mM sodium chloride-8, 2 mM TCEP-9, mM protein_2-10, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.3 mM [U-13C; U-15N] protein_2-11, 10 mM TRIS-HCl pH 8.0-12, 50 mM sodium chloride-13, 2 mM TCEP-14, mM protein_1-15, 100% D2O \| 100% D2O NMR sample composition mM [U-13C; U-15N] protein_1-16, 10 mM TRIS-HCl pH 8.0-17, 50 mM sodium chloride-18, 2 mM TCEP-19, mM protein_2-20, 100% D2O \| 100% D2O	Resolution not provided
3DXB Structure of the UHM domain of Puf60 fused to thioredoxin Deposited 2008-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain F 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.4M ammonium sulfate, 0.05M K-formate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.271
3DXB Structure of the UHM domain of Puf60 fused to thioredoxin Deposited 2008-07-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain D 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.4M ammonium sulfate, 0.05M K-formate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.271
3DXB Structure of the UHM domain of Puf60 fused to thioredoxin Deposited 2008-07-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain G 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.4M ammonium sulfate, 0.05M K-formate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.271
3DXB Structure of the UHM domain of Puf60 fused to thioredoxin Deposited 2008-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain H 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559	Not recorded	CL CHLORIDE ION × 2 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.4M ammonium sulfate, 0.05M K-formate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.271
3DXB Structure of the UHM domain of Puf60 fused to thioredoxin Deposited 2008-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Insufficient information Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain B 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain C 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain D 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain E 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain F 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain G 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559 Chain H 460–499（40 aa） Fragment：Chimera of Thioredoxin 1-109 and Puf60 C-terminal 460-559	Not recorded	CL CHLORIDE ION × 4 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；1.4M ammonium sulfate, 0.05M K-formate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.20 Å R-free 0.271
3UE2 Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 1.23 A resolution Deposited 2011-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 443–559（117 aa） Fragment：RNA binding domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；277 K；2.4 M ammonium sulfate, 0.1M MES pH 6.0, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.23 Å R-free 0.160
3US5 Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 1.38 A resolution Deposited 2011-11-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 443–559（117 aa） Fragment：RRM 3 domain residues 443-559	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；2.40M ammonium sulfate, 0.1M TRIS pH 8.0, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.38 Å R-free 0.181
3UWT Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 2.50 A resolution Deposited 2011-12-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 118–316（199 aa） Fragment：RNA binding domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.5；293 K；0.2M sodium chloride, 1.26M ammonium sulfate, 0.1M CHES pH 9.5, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.240
5KVY CRYSTAL STRUCTURE OF THE TWO TANDEM RRM DOMAINS OF PUF60 BOUND TO A PORTION OF AN ADML PRE-MRNA 3' SPLICE SITE ANALOG Deposited 2016-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 118–316（199 aa） Fragment：tandem RRM domains Chain B 118–316（199 aa） Fragment：tandem RRM domains	Mutation：R123G, C129S, C255A Mutation：R123G, C129S, C255A	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.7；293 K；0.1 M TRIS-HCl, 25% PEG 4000, 5-10 mM Barium Chloride Dihydrate, pH 8.7, mixed with 10 mg/ml protein-nucleic acid mixture in 50 mM TRIS-HCl, pH 8.0, 150 mM NaCl, 20 micromolar EDTA.	Resolution 1.95 Å R-free 0.232
5KW1 Crystal Structure of the Two Tandem RRM Domains of PUF60 Bound to a Modified AdML Pre-mRNA 3' Splice Site Analogue Deposited 2016-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 118–316（199 aa） Fragment：unp residues 118-316 Chain B 118–316（199 aa） Fragment：unp residues 118-316	Mutation：R123G, C129S, C255A Mutation：R123G, C129S, C255A	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.7；293 K；0.1 M Tris-HCl, 25% PEG 4000, 5-10 mM barium chloride dihydrate, pH 8.7, mixed with 10 mg/ml protein-nucleic acid mixture in 50 mM Tris-HCl, pH 8.0, 150 mM NaCl, 20 micromolar EDTA	Resolution 2.10 Å R-free 0.237
5KW6 Two Tandem RRM Domains of PUF60 Bound to an AdML Pre-mRNA 3' Splice Site Analogue with a Modified Binding-Site Nucleic Acid Base Deposited 2016-07-15	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: trimeric	Chain A 118–316（199 aa） Fragment：unp residues 118-316 Chain B 118–316（199 aa） Fragment：unp residues 118-316	Mutation：R123G, C129S, C255A Mutation：R123G, C129S, C255A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.7；293 K；0.1 M Tris-HCl, 25% PEG 4000, 5-10 mM barium chloride dihydrate, pH 8.7, mixed with 10 mg/ml protein-nucleic acid mixture in 50 mM Tris-HCl, pH 8.0, 150 mM NaCl, 20 micromolar EDTA	Resolution 1.91 Å R-free 0.226
5KWQ Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60 Deposited 2016-07-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 118–316（199 aa）	Mutation：R106G, C112S, C238A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；1M Lithium sulfate, 0.1M HEPES (pH 7.5), 5% glycerol, mixed with an equal volume of 10 mg/ml protein	Resolution 2.80 Å R-free 0.256
5KWQ Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60 Deposited 2016-07-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 118–316（199 aa）	Mutation：R106G, C112S, C238A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；1M Lithium sulfate, 0.1M HEPES (pH 7.5), 5% glycerol, mixed with an equal volume of 10 mg/ml protein	Resolution 2.80 Å R-free 0.256
5KWQ Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60 Deposited 2016-07-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 118–316（199 aa） Chain B 118–316（199 aa）	Mutation：R106G, C112S, C238A Mutation：R106G, C112S, C238A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；1M Lithium sulfate, 0.1M HEPES (pH 7.5), 5% glycerol, mixed with an equal volume of 10 mg/ml protein	Resolution 2.80 Å R-free 0.256
6LUR Human PUF60 UHM domain (thioredoxin fusion) in complex with a small molecule binder Deposited 2020-01-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 460–559（100 aa） Chain B 460–559（100 aa） Chain C 460–559（100 aa） Chain D 460–559（100 aa） Chain E 460–559（100 aa） Chain F 460–559（100 aa） Chain G 460–559（100 aa） Chain H 460–559（100 aa）	Not recorded	EVU 4-[2-[4-(aminomethyl)phenyl]phenyl]piperazin-2-one × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.3-1.6M AmSO4, 0.2M potassium formate	Resolution 2.00 Å R-free 0.253
6SLO Crystal structure of PUF60 UHM domain in complex with 7,8 dimethoxyperphenazine Deposited 2019-08-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 417–516（100 aa）	Not recorded	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；1.4M ammonium sulfate, 0.05M K-formate,	Resolution 1.94 Å R-free 0.207
6SLO Crystal structure of PUF60 UHM domain in complex with 7,8 dimethoxyperphenazine Deposited 2019-08-20	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 417–516（100 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；1.4M ammonium sulfate, 0.05M K-formate,	Resolution 1.94 Å R-free 0.207
6SLO Crystal structure of PUF60 UHM domain in complex with 7,8 dimethoxyperphenazine Deposited 2019-08-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 417–516（100 aa）	Not recorded	LJT 2-[4-[3-(8-chloranyl-2,3-dimethoxy-phenothiazin-10-yl)propyl]piperazin-1-yl]ethanol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；1.4M ammonium sulfate, 0.05M K-formate,	Resolution 1.94 Å R-free 0.207
6SLO Crystal structure of PUF60 UHM domain in complex with 7,8 dimethoxyperphenazine Deposited 2019-08-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain D 417–516（100 aa）	Not recorded	LJT 2-[4-[3-(8-chloranyl-2,3-dimethoxy-phenothiazin-10-yl)propyl]piperazin-1-yl]ethanol × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；1.4M ammonium sulfate, 0.05M K-formate,	Resolution 1.94 Å R-free 0.207
7Z3X Crystal structure of FIR RRM1-2 Y115F mutant bound to FUSE ssDNA Deposited 2022-03-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 114–308（195 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；25% PEG3350 0.1M Bis-Tris, pH5.5	Resolution 1.65 Å R-free 0.214
7Z3X Crystal structure of FIR RRM1-2 Y115F mutant bound to FUSE ssDNA Deposited 2022-03-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Monomer；Protein × 1 PDB declaration: dimeric	Chain B 114–308（195 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；25% PEG3350 0.1M Bis-Tris, pH5.5	Resolution 1.65 Å R-free 0.214

13 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PUF60_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–199； UniProt 114–310 Author chain B； PDBConstruct 3–199； UniProt 114–310

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7q8a
Deposition date deposition_date	2021-11-10
Structure title title	Crystal structure of tandem domain RRM1-2 of FUBP-interacting repressor (FIR) bound to FUSE ssDNA fragment
Keywords keywords	RNA recognition motif(RRM), ssDNA, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.77 Å
Radius of gyration Rg (electron density) rg_electron	22.79 Å
Forward intensity I(0) i0	33692200.00
Molecular weight molecular_weight	43195.0 kDa
Excluded volume excluded_volume	53420 Å³
Envelope volume envelope_volume	65343 Å³
Hydration-shell volume shell_volume	24247 Å³
Envelope diameter envelope_diameter	80.9 Å
Shell Rg shell_rg	29.36 Å
Envelope Rg envelope_rg	23.05 Å
Shape Rg shape_rg	22.78 Å
Total Rg total_rg	23.63 Å
Total atoms total_atoms	3031
Residues n_residues	395
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	71.9 Å
Rg (real space) rg_real	23.78 Å
Rg uncertainty (real space) rg_real_error	0.13 Å
I(0) (real space) i0_real	3.2770e+07
I(0) uncertainty (real space) i0_real_error	3.4530e+05
Rg (reciprocal space) rg_reciprocal	23.72 Å
I(0) (reciprocal space) i0_reciprocal	33690000.0000
Solution quality estimate total_estimate	0.6930
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	30.3 Å
Skewness Skewness skewness	0.273
Kurtosis Kurtosis kurtosis	-0.352
Angular range angular_range	— – 0.3350 Å⁻¹
Current regularization parameter α current_alpha	7.2960
Highest regularization parameter α highest_alpha	7719000.0000
Real-space data points n_real_points	65
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.963; Stabil: 0.927; Sysdev: 0.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.358

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Poly(U)-binding-splicing factor PUF60
Molecular weight formula_weight	22046.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3174

SMLQSMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(PGPT)-3') ;
Molecular weight formula_weight	588.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

GT

Entity 3 Entity 3 polymer

Description description	ssDNA
Molecular weight formula_weight	563.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E

TT

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	127

▶

8. Citations (1)

▶

Unit-cell length a length_a	55.696 Å
Unit-cell length b length_b	69.785 Å
Unit-cell length c length_c	107.158 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.050 Å
Low-resolution limit resolution_low	42.500 Å
R factor r_factor	0.2008
R_work r_work	0.1986
R_free r_free	0.2469

fit	/app/data/saxs_computation/q8/7q8a/7q8a.fit
pddf	/app/data/pr_computation/q8/7q8a/7q8a.pr.out
profile	/app/data/saxs_computation/q8/7q8a/7q8a.dat

Crystal structure of tandem domain RRM1-2 of FUBP-interacting repressor (FIR) bound to FUSE ssDNA fragment

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poly(U)-binding-splicing factor PUF60

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)