SAXSdb — 7s2s

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-2 receptor subunit beta

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 2 其他Polymer 3 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 27–236	Fragment：extracellular domain Non-standard monomer：Yes (specific site not provided by mmCIF)	IL2Rb-binding nanobody × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose × 2 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 5.5；295 K；0.23 M ammonium sulfate, 0.08 M Bis Tris pH 5.5, 23% PEG 3350	Resolution 1.93 Å R-free 0.247
2	Other combination Heteromer Protein × 2 其他Polymer 3 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 27–236	Fragment：extracellular domain Non-standard monomer：Yes (specific site not provided by mmCIF)	IL2Rb-binding nanobody × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose × 2 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION；pH 5.5；295 K；0.23 M ammonium sulfate, 0.08 M Bis Tris pH 5.5, 23% PEG 3350	Resolution 1.93 Å R-free 0.247

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7S2S	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2B5I cytokine receptor complex Deposited 2005-09-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 27–240（214 aa）	Mutation：N3Q,N17Q,N45Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；293 K；29% Pentaerythritol Ethoxylate 15/4; 50 mM Ammonium Sulfate; 50 mM Bis Tris, pH 6.1, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.30 Å R-free 0.269
2ERJ Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2 Deposited 2005-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 25–230（206 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.1；295.5 K；MPEG 550, sodium acetate, sodium citrate, phenol, pH 5.1, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 3.00 Å R-free 0.263
2ERJ Crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2 Deposited 2005-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 25–230（206 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.1；295.5 K；MPEG 550, sodium acetate, sodium citrate, phenol, pH 5.1, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 3.00 Å R-free 0.263
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain c 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain f 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 12 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain i 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain N 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Q 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain W 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
3QAZ IL-2 mutant D10 ternary complex Deposited 2011-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Z 24–240（217 aa） Fragment：unp residues 24-240	Mutation：N29Q, N43Q, N71Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；100 mM Bis-Tris, 200 mM NH4SO4, 25% PEG-3350, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.80 Å R-free 0.344
4GS7 Structure of the Interleukin-15 quaternary complex Deposited 2012-08-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 27–240（214 aa）	Mutation：N29Q, N43Q, N71Q Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 1 ACT ACETATE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.75；298 K；22.5% PEG3350, 0.1M BIS-TRIS propane, 0.2M sodium acetate, pH 8.75, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.35 Å R-free 0.227
5M5E Crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor Deposited 2016-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 27–240（214 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4 CYS CYSTEINE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.1M HEPES, pH 7.0, 2M ammonium sulfate	Resolution 2.30 Å R-free 0.235
6E8K Legionella Longbeachae LeSH (Llo2327) bound to the human interleukin-2 receptor beta pTyr387 peptide Deposited 2018-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 381–393（13 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；296 K；PEG3000, sodium malonate	Resolution 1.71 Å R-free 0.211
9KMC Cryo-EM structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2 and anti-CD25 Fab S417 Deposited 2024-11-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 27–240（214 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å

7 other PDB entries and 19 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL2RB_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–210； UniProt 27–236 Author chain D； PDBConstruct 1–210； UniProt 27–236

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7s2s
Deposition date deposition_date	2021-09-03
Structure title title	nanobody bound to Interleukin-2Rbeta
Keywords keywords	nanobody, PROTEIN BINDING, cytokine receptor; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	35.10 Å
Radius of gyration Rg (electron density) rg_electron	34.84 Å
Forward intensity I(0) i0	102951000.00
Molecular weight molecular_weight	78003.0 kDa
Excluded volume excluded_volume	96224 Å³
Envelope volume envelope_volume	128290 Å³
Hydration-shell volume shell_volume	32801 Å³
Envelope diameter envelope_diameter	133.3 Å
Shell Rg shell_rg	38.51 Å
Envelope Rg envelope_rg	34.45 Å
Shape Rg shape_rg	34.82 Å
Total Rg total_rg	35.17 Å
Total atoms total_atoms	5458
Residues n_residues	651
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	126.4 Å
Rg (real space) rg_real	35.35 Å
Rg uncertainty (real space) rg_real_error	1.61 Å
I(0) (real space) i0_real	1.0300e+08
I(0) uncertainty (real space) i0_real_error	1.9690e+06
Rg (reciprocal space) rg_reciprocal	35.20 Å
I(0) (reciprocal space) i0_reciprocal	102900000.0000
Solution quality estimate total_estimate	0.8446
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	123.6 Å
Skewness Skewness skewness	0.499
Kurtosis Kurtosis kurtosis	-0.178
Angular range angular_range	— – 0.2250 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	8832000.0000
Real-space data points n_real_points	46
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.763; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.773; Smooth: 0.913

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	IL2Rb-binding nanobody
Molecular weight formula_weight	16581.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,A
Atom count atom_count	5660

QVQLQESGGGSVQAGGSLRLSCAASSYTISSVCMGWFRQAPGKEREGVAGIAPDGSTGYGDSVKGRFTISKDNAKNTLYLQMNSLKPEDTAMYYCAAASPGRCFLPRTALEPALYYNWGQGTQVTVSSGAPGSGLNDIFEAQKIEWHEHHHHHH

来源 Source

来源生物 organism	Camelus bactrianus
NCBI Class编号 ncbi_taxonomy_id	9837
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Interleukin-2 receptor subunit beta
Molecular weight formula_weight	25199.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	570.5 kDa
Source method src_method	man
Copy count entity_count	4

Entity 4 Entity 4 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	193

▼

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	7s2sA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7s2sC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	42.698 Å
Unit-cell length b length_b	69.505 Å
Unit-cell length c length_c	91.721 Å
Unit-cell angle α angle_alpha	99.57 °
Unit-cell angle β angle_beta	99.85 °
Unit-cell angle γ angle_gamma	90.19 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	1.930 Å
Low-resolution limit resolution_low	44.530 Å
R factor r_factor	0.2137
R_work r_work	0.2127
R_free r_free	0.2471

fit	/app/data/saxs_computation/s2/7s2s/7s2s.fit
pddf	/app/data/pr_computation/s2/7s2s/7s2s.pr.out
profile	/app/data/saxs_computation/s2/7s2s/7s2s.dat

nanobody bound to Interleukin-2Rbeta

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-2 receptor subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)