SAXSdb — 7s7h

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methane monooxygenase component A alpha chain

Methylosinus trichosporium OB3b

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase beta chain × 2 （A0A2D2D5X7） Methane monooxygenase gamma chain × 2 （A0A2D2D0T0） Methane monooxygenase regulatory protein B × 2 （A0A2D2D0T8） FE (III) ION × 4 1,2-ETHANEDIOL × 18 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2D2D5X0_METTR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–515； UniProt 12–526 Author chain E； PDBConstruct 1–515； UniProt 12–526

Methane monooxygenase beta chain

Methylosinus trichosporium OB3b

UniProt A0A2D2D5X7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A alpha chain × 2 （A0A2D2D5X0） Methane monooxygenase gamma chain × 2 （A0A2D2D0T0） Methane monooxygenase regulatory protein B × 2 （A0A2D2D0T8） FE (III) ION × 4 1,2-ETHANEDIOL × 18 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2D2D5X7_METTR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–392； UniProt 4–395 Author chain F； PDBConstruct 1–392； UniProt 4–395

Methane monooxygenase gamma chain

Methylosinus trichosporium OB3b

UniProt A0A2D2D0T0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A alpha chain × 2 （A0A2D2D5X0） Methane monooxygenase beta chain × 2 （A0A2D2D5X7） Methane monooxygenase regulatory protein B × 2 （A0A2D2D0T8） FE (III) ION × 4 1,2-ETHANEDIOL × 18 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2D2D0T0_METTR
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–168； UniProt 2–169 Author chain G； PDBConstruct 1–168； UniProt 2–169

Methane monooxygenase regulatory protein B

Methylosinus trichosporium OB3b

UniProt A0A2D2D0T8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A alpha chain × 2 （A0A2D2D5X0） Methane monooxygenase beta chain × 2 （A0A2D2D5X7） Methane monooxygenase gamma chain × 2 （A0A2D2D0T0） FE (III) ION × 4 1,2-ETHANEDIOL × 18 water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2D2D0T8_METTR
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–131； UniProt 3–133 Author chain H； PDBConstruct 1–131； UniProt 3–133

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7s7h
Deposition date deposition_date	2021-09-16
Structure title title	Complex structure of Methane monooxygenase hydroxylase and regulatory subunit DBL2
Keywords keywords	RESOLVASE, HYDROLASE, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7s7h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7s7h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7s7h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.36 Å
Rg (electron density)	40.05 Å
Total Rg	40.43 Å
Atom count	19490
Residues	2410
Excluded volume	344920 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7s7h__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Methane monooxygenase component A alpha chain
Molecular weight formula_weight	58971.0 kDa
EC 编号 ec_number	1.-.-.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	19955

DALKVNRAPVGVEPQEVHKWLQSFNWDFKENRTKYPTKYHMANETKEQFKVIAKEYARMEAAKDERQFGTLLDGLTRLGAGNKVHPRWGETMKVISNFLEVGEYNAIAASAMLWDSATAAEQKNGYLAQVLDEIRHTHQCAFINHYYSKHYHDPAGHNDARRTRAIGPLWKGMKRVFADGFISGDAVECSVNLQLVGEACFTNPLIVAVTEWASANGDEITPTVFLSVETDELRHMANGYQTVVSIANDPASAKFLNTDLNNAFWTQQKYFTPVLGYLFEYGSKFKVEPWVKTWNRWVYEDWGGIWIGRLGKYGVESPASLRDAKRDAYWAHHDLALAAYAMWPLGFARLALPDEEDQAWFEANYPGWADHYGKIFNEWKKLGYEDPKSGFIPYQWLLANGHDVYIDRVSQVPFIPSLAKGTGSLRVHEFNGKKHSLTDDWGERQWLIEPERYECHNVFEQYEGRELSEVIAEGHGVRSDGKTLIAQPHTRGDNLWTLEDIKRAGCVFPDPLAKF

Source Source

Source organism organism	Methylosinus trichosporium OB3b
NCBI taxonomy ID ncbi_taxonomy_id	595536
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Methane monooxygenase beta chain
Molecular weight formula_weight	44948.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

PQSSQVTKRGLTDPERAAIIAAAVPDHALDTQRKYHYFIQPRWKRLSEYEQLSCYAQPNPDWIAGGLDWGDWTQKFHGGRPSWGNESTELRTTDWYRHRDPARRWHHPYVKDKSEEARYTQRFLAAYSSEGSIRTIDPYWRDEILNKYFGALLYSEYGLFNAHSSVGRDCLSDTIRQTAVFAALDKVDNAQMIQMERLFIAKLVPGFDASTDVPKKIWTTDPIYSGARATVQEIWQGVQDWNEILWAGHAVYDATFGQFARREFFQRLATVYGDTLTPFFTAQSQTYFQTTRGAIDDLFVYCLANDSEFGAHNRTFLNAWTEHYLASSVAALKDFVGLYAKVEKVAGATDRAGVSEALQRVFGDWKIDYADKIGFRVDVDQKVDAVLAGYKN

Source Source

Source organism organism	Methylosinus trichosporium OB3b
NCBI taxonomy ID ncbi_taxonomy_id	595536
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Methane monooxygenase gamma chain
Molecular weight formula_weight	19313.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

AKREPIHDNSIRTEWEAKIAKLTSVDQATKFIQDFRLAYTSPFRKSYDIDVDYQYIERKIEEKLSVLKTEKLPVADLITKATTGEDAAAVEATWIAKIKAAKSKYEAERIHIEFRQLYKPPVLPVNVFLRTDAALGTVLMEIRNTDYYGTPLEGLRKERGVKVLHLQA

Source Source

Source organism organism	Methylosinus trichosporium OB3b
NCBI taxonomy ID ncbi_taxonomy_id	595536
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Methane monooxygenase regulatory protein B
Molecular weight formula_weight	14119.0 kDa
Mutation mutation	S109A,T111A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

SAHNAYNAGIMQKTGKAFADEFFAEENQVVHESNAVVLVLMKSDEIDAIIEDIVLKGGKAKNPSIVVEDKAGFWWIKADGAIEIDAAEAGELLGKPFSVYDLLINVASAVGRAYTLGTKFTITSELMGLDR

Source Source

Source organism organism	Methylosinus trichosporium OB3b
NCBI taxonomy ID ncbi_taxonomy_id	595536
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	434

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	7s7hD01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

Domain ID domain_id	7s7hH01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

▶

Unit-cell length a length_a	102.516 Å
Unit-cell length b length_b	106.357 Å
Unit-cell length c length_c	296.685 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	74.170 Å
R factor r_factor	0.2213
R_work r_work	0.2192
R_free r_free	0.2606

Complex structure of Methane monooxygenase hydroxylase and regulatory subunit DBL2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methane monooxygenase component A alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Methane monooxygenase beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Methane monooxygenase gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Methane monooxygenase regulatory protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s7h__assembly_1__model_1

7s7h__assembly_1__model_1 | I(q)

7s7h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)