SAXSdb — 7s7q

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Merozoite surface protein P41

Plasmodium falciparum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Merozoite surface protein P12 × 1 （C6KSX0） 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CADMIUM ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PF41_PLAF7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–351； UniProt 20–368

Merozoite surface protein P12

Plasmodium falciparum

UniProt C6KSX0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Merozoite surface protein P41 × 1 （Q8I1Y0） 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CADMIUM ION × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PF12_PLAF7
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 4–280； UniProt 28–304

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7s7q
Deposition date deposition_date	2021-09-17
Structure title title	Heterodimeric complex of Pf12 and Pf41 of Plasmodium falciparum
Keywords keywords	6-cysteine protein, s48/45 domain, complex, heterodimer, UNKNOWN FUNCTION; UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7s7q__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7s7q__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7s7q__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.16 Å
Rg (electron density)	27.22 Å
Total Rg	27.96 Å
Atom count	4216
Residues	572
Excluded volume	74303 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7s7q__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Merozoite surface protein P41
Molecular weight formula_weight	39932.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4219

GASKSHKCDFTKEKYLLSGEKEVSCEIDANPSDDITFICPNKIDSLCFHTVNISKNINQNKSTMSIQDLLYGSVVYGNTLFISPYVRTNTPFYCFCNLDTVTIQKFLKINRFLKDDDELSEADVMKHLKGGNVSEAQADEYLNKALNRFKKMKDLSKFFNDQADNTTKLNLPKSLNIPNDILNYDVYNSSNNRNDIVVKDEVTNKQIISKRGIMSVFVRSNNNVIKGCDFGNNNKNYFSHPISVAGKVNNKVCKIQGKPGELVGFKCAFEENGKVEPPNCFDQVLHKNKVTDLKTLIPGYASYTNKHSSKYPYYLKIPHFVNEQYTIQCKCKSNNSQNEYTFELDIQPGES

Source Source

Source organism organism	Plasmodium falciparum
NCBI taxonomy ID ncbi_taxonomy_id	36329
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Merozoite surface protein P12
Molecular weight formula_weight	31742.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GASNLTCDFNDVYKLEFHPNQQTSVTKLCNLTPNVLEKVTIKCGSDKLNYNLYPPTCFEEVYASRNMMHLKKIKEFVIGSSMFMRRSLTPNKINEVSFRIPPNMMPEKPIYCFCENKKTITINGSNGNPSSKKDIINRGIVEIIIPSLNEKVKGCDFTTSESTIFSKGYSINEISNKSSNNQQDIVCTVKAHANDLIGFKCPSNYSVEPHDCFVSAFNLSGKNENLENKLKLTNIIMDHYNNTFYSRLPSLISDNWKFFCVCSKDNEKKLVFTVEASISS

Source Source

Source organism organism	Plasmodium falciparum
NCBI taxonomy ID ncbi_taxonomy_id	36329
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	CADMIUM ION
Molecular weight formula_weight	112.4 kDa
Source method src_method	syn
Copy count entity_count	7

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	7s7qA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2860 —

Domain ID domain_id	7s7qB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2860 —

Domain ID domain_id	7s7qB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	2860 —

▶

Unit-cell length a length_a	73.712 Å
Unit-cell length b length_b	73.712 Å
Unit-cell length c length_c	332.241 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	—

Resolution resolution	2.850 Å
Low-resolution limit resolution_low	47.160 Å
R factor r_factor	0.2327
R_work r_work	0.2299
R_free r_free	0.2851

Heterodimeric complex of Pf12 and Pf41 of Plasmodium falciparum

1. Protein Identity and Related Structures Protein Identity & Related Structures

Merozoite surface protein P41

State in the Current Structure

Other States of the Same Protein in the Database

Merozoite surface protein P12

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s7q__assembly_1__model_1

7s7q__assembly_1__model_1 | I(q)

7s7q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)

Heterodimeric complex of Pf12 and Pf41 of Plasmodium falciparum

1. Protein Identity and Related Structures Protein Identity & Related Structures

Merozoite surface protein P41

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Merozoite surface protein P12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s7q__assembly_1__model_1

7s7q__assembly_1__model_1 | I(q)

7s7q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)