7sc7

Synechocystis PCC 6803 Phycobilisome core from up-down rod conformation

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin alpha chain

OrganismNot specified

UniProt Q01951

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 86	Allophycocyanin beta chain × 34 （Q01952） Allophycocyanin subunit alpha-B × 2 （P72870） Allophycocyanin subunit beta-18 × 2 （P74551） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Phycobilisome rod-core linker polypeptide CpcG × 6 （P73093） Sll1873 protein × 2 （P74135） PHYCOCYANOBILIN × 72	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHAA_SYNY3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AA； PDBConstruct 1–161； UniProt 1–161 Author chain AC； PDBConstruct 1–161； UniProt 1–161 Author chain AH； PDBConstruct 1–161； UniProt 1–161 Author chain AJ； PDBConstruct 1–161； UniProt 1–161 Author chain AN； PDBConstruct 1–161； UniProt 1–161 Author chain AP； PDBConstruct 1–161； UniProt 1–161 Author chain AR； PDBConstruct 1–161； UniProt 1–161 Author chain AV； PDBConstruct 1–161； UniProt 1–161 Author chain AX； PDBConstruct 1–161； UniProt 1–161 Author chain AZ； PDBConstruct 1–161； UniProt 1–161 Author chain BH； PDBConstruct 1–161； UniProt 1–161 Author chain BJ； PDBConstruct 1–161； UniProt 1–161 Author chain BO； PDBConstruct 1–161； UniProt 1–161 Author chain BQ； PDBConstruct 1–161； UniProt 1–161 Author chain BU； PDBConstruct 1–161； UniProt 1–161 Author chain BW； PDBConstruct 1–161； UniProt 1–161 Author chain BY； PDBConstruct 1–161； UniProt 1–161 Author chain CB； PDBConstruct 1–161； UniProt 1–161 Author chain CD； PDBConstruct 1–161； UniProt 1–161 Author chain CF； PDBConstruct 1–161； UniProt 1–161 Author chain CP； PDBConstruct 1–161； UniProt 1–161 Author chain CR； PDBConstruct 1–161； UniProt 1–161 Author chain CT； PDBConstruct 1–161； UniProt 1–161 Author chain CW； PDBConstruct 1–161； UniProt 1–161 Author chain CY； PDBConstruct 1–161； UniProt 1–161 Author chain DA； PDBConstruct 1–161； UniProt 1–161 Author chain DG； PDBConstruct 1–161； UniProt 1–161 Author chain DI； PDBConstruct 1–161； UniProt 1–161 Author chain DK； PDBConstruct 1–161； UniProt 1–161 Author chain DN； PDBConstruct 1–161； UniProt 1–161 Author chain DP； PDBConstruct 1–161； UniProt 1–161 Author chain DR； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin beta chain

OrganismNot specified

UniProt Q01952

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 86	Allophycocyanin alpha chain × 32 （Q01951） Allophycocyanin subunit alpha-B × 2 （P72870） Allophycocyanin subunit beta-18 × 2 （P74551） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Phycobilisome rod-core linker polypeptide CpcG × 6 （P73093） Sll1873 protein × 2 （P74135） PHYCOCYANOBILIN × 72	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCB_SYNY3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AB； PDBConstruct 1–161； UniProt 1–161 Author chain AD； PDBConstruct 1–161； UniProt 1–161 Author chain AF； PDBConstruct 1–161； UniProt 1–161 Author chain AI； PDBConstruct 1–161； UniProt 1–161 Author chain AL； PDBConstruct 1–161； UniProt 1–161 Author chain AO； PDBConstruct 1–161； UniProt 1–161 Author chain AQ； PDBConstruct 1–161； UniProt 1–161 Author chain AS； PDBConstruct 1–161； UniProt 1–161 Author chain AU； PDBConstruct 1–161； UniProt 1–161 Author chain AW； PDBConstruct 1–161； UniProt 1–161 Author chain AY； PDBConstruct 1–161； UniProt 1–161 Author chain BI； PDBConstruct 1–161； UniProt 1–161 Author chain BK； PDBConstruct 1–161； UniProt 1–161 Author chain BM； PDBConstruct 1–161； UniProt 1–161 Author chain BP； PDBConstruct 1–161； UniProt 1–161 Author chain BS； PDBConstruct 1–161； UniProt 1–161 Author chain BV； PDBConstruct 1–161； UniProt 1–161 Author chain BX； PDBConstruct 1–161； UniProt 1–161 Author chain BZ； PDBConstruct 1–161； UniProt 1–161 Author chain CC； PDBConstruct 1–161； UniProt 1–161 Author chain CE； PDBConstruct 1–161； UniProt 1–161 Author chain CG； PDBConstruct 1–161； UniProt 1–161 Author chain CQ； PDBConstruct 1–161； UniProt 1–161 Author chain CS； PDBConstruct 1–161； UniProt 1–161 Author chain CU； PDBConstruct 1–161； UniProt 1–161 Author chain CX； PDBConstruct 1–161； UniProt 1–161 Author chain CZ； PDBConstruct 1–161； UniProt 1–161 Author chain DB； PDBConstruct 1–161； UniProt 1–161 Author chain DH； PDBConstruct 1–161； UniProt 1–161 Author chain DJ； PDBConstruct 1–161； UniProt 1–161 Author chain DL； PDBConstruct 1–161； UniProt 1–161 Author chain DO； PDBConstruct 1–161； UniProt 1–161 Author chain DQ； PDBConstruct 1–161； UniProt 1–161 Author chain DS； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin subunit alpha-B

OrganismNot specified

UniProt P72870

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 86	Allophycocyanin alpha chain × 32 （Q01951） Allophycocyanin beta chain × 34 （Q01952） Allophycocyanin subunit beta-18 × 2 （P74551） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Phycobilisome rod-core linker polypeptide CpcG × 6 （P73093） Sll1873 protein × 2 （P74135） PHYCOCYANOBILIN × 72	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCD_SYNY3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AE； PDBConstruct 1–161； UniProt 1–161 Author chain BL； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin subunit beta-18

OrganismNot specified

UniProt P74551

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 86	Allophycocyanin alpha chain × 32 （Q01951） Allophycocyanin beta chain × 34 （Q01952） Allophycocyanin subunit alpha-B × 2 （P72870） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Phycobilisome rod-core linker polypeptide CpcG × 6 （P73093） Sll1873 protein × 2 （P74135） PHYCOCYANOBILIN × 72	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCF_SYNY3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AK； PDBConstruct 1–169； UniProt 1–169 Author chain BR； PDBConstruct 1–169； UniProt 1–169

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

OrganismNot specified

UniProt Q01950

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 86	Allophycocyanin alpha chain × 32 （Q01951） Allophycocyanin beta chain × 34 （Q01952） Allophycocyanin subunit alpha-B × 2 （P72870） Allophycocyanin subunit beta-18 × 2 （P74551） Phycobiliprotein ApcE × 2 （Q55544） Phycobilisome rod-core linker polypeptide CpcG × 6 （P73093） Sll1873 protein × 2 （P74135） PHYCOCYANOBILIN × 72	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYC1_SYNY3
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain BA； PDBConstruct 1–67； UniProt 1–67 Author chain BB； PDBConstruct 1–67； UniProt 1–67 Author chain CI； PDBConstruct 1–67； UniProt 1–67 Author chain CJ； PDBConstruct 1–67； UniProt 1–67 Author chain DD； PDBConstruct 1–67； UniProt 1–67 Author chain DU； PDBConstruct 1–67； UniProt 1–67

Phycobiliprotein ApcE

OrganismNot specified

UniProt Q55544

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 86	Allophycocyanin alpha chain × 32 （Q01951） Allophycocyanin beta chain × 34 （Q01952） Allophycocyanin subunit alpha-B × 2 （P72870） Allophycocyanin subunit beta-18 × 2 （P74551） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q01950） Phycobilisome rod-core linker polypeptide CpcG × 6 （P73093） Sll1873 protein × 2 （P74135） PHYCOCYANOBILIN × 72	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCE_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain BD； PDBConstruct 1–896； UniProt 1–896 Author chain CL； PDBConstruct 1–896； UniProt 1–896

Phycobilisome rod-core linker polypeptide CpcG

OrganismNot specified

UniProt P73093

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 86	Allophycocyanin alpha chain × 32 （Q01951） Allophycocyanin beta chain × 34 （Q01952） Allophycocyanin subunit alpha-B × 2 （P72870） Allophycocyanin subunit beta-18 × 2 （P74551） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Sll1873 protein × 2 （P74135） PHYCOCYANOBILIN × 72	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYG_SYNY3
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain BF； PDBConstruct 1–249； UniProt 1–249 Author chain CN； PDBConstruct 1–249； UniProt 1–249 Author chain DE； PDBConstruct 1–249； UniProt 1–249 Author chain DF； PDBConstruct 1–249； UniProt 1–249 Author chain DV； PDBConstruct 1–249； UniProt 1–249 Author chain DW； PDBConstruct 1–249； UniProt 1–249

Sll1873 protein

OrganismNot specified

UniProt P74135

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 86	Allophycocyanin alpha chain × 32 （Q01951） Allophycocyanin beta chain × 34 （Q01952） Allophycocyanin subunit alpha-B × 2 （P72870） Allophycocyanin subunit beta-18 × 2 （P74551） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Phycobilisome rod-core linker polypeptide CpcG × 6 （P73093） PHYCOCYANOBILIN × 72	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P74135_SYNY3
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain BG； PDBConstruct 1–121； UniProt 1–121 Author chain CO； PDBConstruct 1–121； UniProt 1–121

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7sc7
Deposition date deposition_date	2021-09-27
Structure title title	Synechocystis PCC 6803 Phycobilisome core from up-down rod conformation
Keywords keywords	Complex, light harvesting, pigment, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7sc7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7sc7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7sc7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	76.78 Å
Rg (electron density)	76.32 Å
Total Rg	76.44 Å
Atom count	107930
Residues	13756
Excluded volume	1928300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7sc7__assembly_1__model_1`	86-meric （86）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Allophycocyanin alpha chain
Molecular weight formula_weight	17429.8 kDa
Source method src_method	nat
Copy count entity_count	32

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AC,AH,AJ,AN,AP,AR,AV,AX,AZ,BH,BJ,BO,BQ,BU,BW,BY,CB,CD,CF,CP,CR,CT,CW,CY,DA,DG,DI,DK,DN,DP,DR
Atom count atom_count	107930

MSIVTKSIVNADAEARYLSPGELDRIKAFVTGGAARLRIAETLTGSRETIVKQAGDRLFQKRPDIVSPGGNAYGEEMTATCLRDMDYYLRLVTYGVVSGDVTPIEEIGLVGVREMYRSLGTPIEAVAQSVREMKEVASGLMSSDDAAEASAYFDFVIGKMS

Entity 2 Entity 2 polymer

Description description	Allophycocyanin beta chain
Molecular weight formula_weight	17231.6 kDa
Source method src_method	nat
Copy count entity_count	34

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB,AD,AF,AI,AL,AO,AQ,AS,AU,AW,AY,BI,BK,BM,BP,BS,BV,BX,BZ,CC,CE,CG,CQ,CS,CU,CX,CZ,DB,DH,DJ,DL,DO,DQ,DS

MQDAITAVINSADVQGKYLDGAAMDKLKSYFASGELRVRAASVISANAATIVKEAVAKSLLYSDVTRPGGNMYTTRRYAACIRDLDYYLRYATYAMLAGDASILDERVLNGLKETYNSLGVPISSTVQAIQAIKEVTASLVGADAGKEMGVYLDYICSGLS

Entity 3 Entity 3 polymer

Description description	Allophycocyanin subunit alpha-B
Molecular weight formula_weight	17940.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE,BL

MSVVSQVILQADDQLRYPTSGELKGIQAFLTTGAQRIRIAETLAENEKKIVDQAQKQLFKKHPEYRAPGGNAYGQRQYNQCLRDYGWYLRLVTYGVLAGNKEPIETTGLIGVKEMYNSLNVPVPGMVDAVTVLKDAALGLLSAEDANETAPYFDYIIQFMS

Entity 4 Entity 4 polymer

Description description	Allophycocyanin subunit beta-18
Molecular weight formula_weight	18911.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK,BR

MRDAVTTLIKNYDLTGRYLDRNAMDELKAYFESGSARIAAAAMINANSATIVKRAAAQLFEEIPELIRPSGNAYTTRRFSACLRDMDYYLRYASYALIAADNNVLDERVLQGLRETYNSLGVPIGPTVRGIQIMKEMIEAMAEDSSLNSTDFIASPFDHMTRELSELSV

Entity 5 Entity 5 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7817.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA,BB,CI,CJ,DD,DU

MRMFRITACVPSQTRIRTQRELQNTYFTKLVPYDNWFREQQRIMKMGGKIVKVELATGRPGTNAGLA

Entity 6 Entity 6 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	100412.7 kDa
EC 编号 ec_number	4.-.-.-
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD,CL

MSVKASGGSSLARPQLYQTVPVSAISQAEQQDRFLEGSELNELTAYFQSGALRLEIAETLTQNADLIVSRAANRIFTGGSPLSYLEKPVERQPALVGASSDSRNGSVTYAESNGSGGLFGGLRSVFSSTGPIPPGFRPINIARYGPSNMQKSLRDMSWFLRYTTYAIVAGDPNIIVVNTRGLKEVIENACSIDATIVAIQEMRAASADYFRNNAQAKEIVLQYFDILLSEFKAPTPANKVRQGPSNDIQGLELPQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGRGPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLGVEAQECRNWGMQQDLFSYSAPFRKVPQFITTFAQYDRPLPDQHVYGSGNDPLEIQFGAIFPKETRNPSKRPAPFNKDTKRILIHRGPAVNNQVGNPSAVGEFPGSLGAKVFRLNGGLPGAKVGKNTGTSVKFGESSTQALIRAAYRQVFGRDLYEGQRLSVAEIQLENGDISVREFIKRLAKSELFLKLYWAPHYVCKAIEYMHRRLLGRPTYGRQEMNQYFDIASKQGFYAVVEAMIDSKEYSDAFGEDTVPYERYLTPGGLQMRSARVGSLREDIGQRVDKEVTPRFVELGQVSAIRTEPEIAYRSNQGVTRQRQQTKVFKLVSTYDKVAVKNAIRAAYRQVFERDLEPYIINSEFTALESKLSNNEINVKEFIEGLGTSELYMKEFYAPYPNTKVIEMGTKHFLGRAPLNQKEIQQYNQILASQGLKAFIGAMVNGMEYLQTFGEDTVPYRRFPTLPAANFPNTERLYNKLTKQDKELVVPSFTPVVKVGG

Entity 7 Entity 7 polymer

Description description	Phycobilisome rod-core linker polypeptide CpcG
Molecular weight formula_weight	28938.8 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF,CN,DE,DF,DV,DW

MALPLLNYAPKSQNVRVEGYEIGSEEKPVVFTTENILSSSDMDNLIEAAYRQIFFHAFKWDREKVLESQLRNGQITVRDFVRGLLLSNTFRNSFYEKNSNYRFVEHCVQKILGRDVYSEREKIAWSIVVATKGYQGLIDDLLNSDEYLNNFGYDTVPYQRRRNLPGREAGELPFNIKSPRYDAYHRRQLGFPQIVWQNEVRRFIPQEKKLTAGNPMNFLGMARSINPAANTIPKVSAQNINIEASVPRR

Entity 8 Entity 8 polymer

Description description	Sll1873 protein
Molecular weight formula_weight	12928.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BG,CO

MLKKLFGAKKEFYVQLDESQAPAQVEEADVAIVKSEVAPVEKPAPTTSKKTSIKKKSATKAAAPVETPASAPVAPAPKAKVDPSQVAFASGDPIPQNVARRTPGPSLNRFKEMARQVKVKR

Entity 9 Entity 9 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	72

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	202719

Synechocystis PCC 6803 Phycobilisome core from up-down rod conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin subunit alpha-B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin subunit beta-18

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome rod-core linker polypeptide CpcG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sll1873 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7sc7__assembly_1__model_1

7sc7__assembly_1__model_1 | I(q)

7sc7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer