SAXSdb — 7tzk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Epidermal growth factor receptor kinase substrate 8

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	T3SS secreted effector NleH homolog × 1 （B7ULW4） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	T3SS secreted effector NleH homolog × 1 （B7ULW4） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EPS8_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–64； UniProt 531–591 Author chain B； PDBConstruct 4–64； UniProt 531–591

T3SS secreted effector NleH homolog

OrganismNot specified

UniProt B7ULW4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Epidermal growth factor receptor kinase substrate 8 × 1 （Q12929） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Epidermal growth factor receptor kinase substrate 8 × 1 （Q12929） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B7ULW4_ECO27
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–12； UniProt 121–132 Author chain D； PDBConstruct 1–12； UniProt 121–132

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7tzk
Deposition date deposition_date	2022-02-15
Structure title title	EPS8 SH3 Domain with NleH1 PxxDY Motif
Keywords keywords	NleH kinase, protein-protein interaction, SH3 domain, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7tzk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7tzk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7tzk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	13.60 Å
Rg (electron density)	12.14 Å
Total Rg	13.59 Å
Atom count	1185
Residues	76
Excluded volume	10612 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7tzk__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7tzk__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Epidermal growth factor receptor kinase substrate 8
Molecular weight formula_weight	7372.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2701

SNAQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	T3SS secreted effector NleH homolog
Molecular weight formula_weight	1330.4 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

PPELPSVDYNSL

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	301

▶

Unit-cell length a length_a	34.681 Å
Unit-cell length b length_b	35.280 Å
Unit-cell length c length_c	53.647 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	105.57 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.430 Å
Low-resolution limit resolution_low	32.280 Å
R factor r_factor	0.1984
R_work r_work	0.1950
R_free r_free	0.2336

EPS8 SH3 Domain with NleH1 PxxDY Motif

1. Protein Identity and Related Structures Protein Identity & Related Structures

Epidermal growth factor receptor kinase substrate 8

State in the Current Structure

Other States of the Same Protein in the Database

T3SS secreted effector NleH homolog

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7tzk__assembly_1__model_1

7tzk__assembly_1__model_1 | I(q)

7tzk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

EPS8 SH3 Domain with NleH1 PxxDY Motif

1. Protein Identity and Related Structures Protein Identity & Related Structures

Epidermal growth factor receptor kinase substrate 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T3SS secreted effector NleH homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7tzk__assembly_1__model_1

7tzk__assembly_1__model_1 | I(q)

7tzk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)