7u06

Structure of the yeast TRAPPII-Rab11/Ypt32 complex in the closed/open state (composite structure)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Trafficking protein particle complex II-specific subunit 65

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS65_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–560； UniProt 1–560 Author chain c； PDBConstruct 1–560； UniProt 1–560

TRAPP-associated protein TCA17

OrganismNot specified

UniProt P32613

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCA17_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–152； UniProt 1–152 Author chain d； PDBConstruct 1–152； UniProt 1–152

Trafficking protein particle complex subunit 33

OrganismNot specified

UniProt Q99394

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS33_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–268； UniProt 1–268 Author chain e； PDBConstruct 1–268； UniProt 1–268

Trafficking protein particle complex subunit BET3

OrganismNot specified

UniProt P36149

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BET3_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–193； UniProt 1–193 Author chain I； PDBConstruct 1–193； UniProt 1–193 Author chain f； PDBConstruct 1–193； UniProt 1–193 Author chain i； PDBConstruct 1–193； UniProt 1–193

Trafficking protein particle complex subunit BET5

OrganismNot specified

UniProt Q03630

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BET5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–159； UniProt 1–159 Author chain g； PDBConstruct 1–159； UniProt 1–159

Trafficking protein particle complex subunit 23

OrganismNot specified

UniProt Q03784

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS23_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–219； UniProt 1–219 Author chain h； PDBConstruct 1–219； UniProt 1–219

Trafficking protein particle complex subunit 31

OrganismNot specified

UniProt Q03337

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 20 × 2 （P38334） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS31_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–283； UniProt 1–283 Author chain j； PDBConstruct 1–283； UniProt 1–283

Trafficking protein particle complex subunit 20

OrganismNot specified

UniProt P38334

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRS20_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–175； UniProt 1–175 Author chain k； PDBConstruct 1–175； UniProt 1–175

GTP-binding protein YPT32/YPT11

Saccharomyces cerevisiae

UniProt P51996

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YPT32_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain l； PDBConstruct 1–220； UniProt 1–220

Trafficking protein particle complex II-specific subunit 130

OrganismNot specified

UniProt Q03660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 120 × 2 （Q04183） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TR130_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain B； PDBConstruct 1–1102； UniProt 1–1102 Author chain b； PDBConstruct 1–1102； UniProt 1–1102

Trafficking protein particle complex II-specific subunit 120

OrganismNot specified

UniProt Q04183

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Trafficking protein particle complex II-specific subunit 65 × 2 （P32893） TRAPP-associated protein TCA17 × 2 （P32613） Trafficking protein particle complex subunit 33 × 2 （Q99394） Trafficking protein particle complex subunit BET3 × 4 （P36149） Trafficking protein particle complex subunit BET5 × 2 （Q03630） Trafficking protein particle complex subunit 23 × 2 （Q03784） Trafficking protein particle complex subunit 31 × 2 （Q03337） Trafficking protein particle complex subunit 20 × 2 （P38334） GTP-binding protein YPT32/YPT11 × 1 （P51996） Trafficking protein particle complex II-specific subunit 130 × 2 （Q03660） Trafficking protein particle complex II-specific subunit 130 × 2 Trafficking protein particle complex II-specific subunit 65 × 2 PALMITIC ACID × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TR120_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain A； PDBConstruct 1–1289； UniProt 1–1289 Author chain a； PDBConstruct 1–1289； UniProt 1–1289

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7u06
Deposition date deposition_date	2022-02-17
Structure title title	Structure of the yeast TRAPPII-Rab11/Ypt32 complex in the closed/open state (composite structure)
Keywords keywords	complex, GTPase, Guanosine Exchange Factor, GEF, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7u06__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7u06__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7u06__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	104.80 Å
Total Rg	104.50 Å
Atom count	127462
Residues	8151
Excluded volume	1144900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7u06__assembly_1__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	Trafficking protein particle complex II-specific subunit 65
Molecular weight formula_weight	63434.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c
Atom count atom_count	127470

MECFVPLRCDLDGSNIEQLRQSHLSRKFIIFDEQLNLWLWFQGNSQENKRFVLQNMIILINEAQVTRTSTIDDYFTQVENNENLWRLKNDCCSKILFKSNVVMNNGYNNQIKFVFEYKSVDANFNNQDSLQDPQAKYTLDKYSSEEILPSFEPVYSWSSAATKSSKNTNNHLEKNNRATHRVSSKNSEVHEADVSRNPNTFTLKLQYPIFSLLNMRLRNISLKSEHCILSSLDFQTSKASEQLTKKFIYPQEHNSFLKLNFQEISYKLIDGTSQIELDPICPLKVPLTAFSYDSISATFKLVLLPKSTQPHRVKITLAYELELHPNLKLPVRTSWETEVTLKRSMPISSTSSQYSSNNNNTNHSASFNGAANNVNSGGLANLRLGGVSSSRFSLGAASTTSLVNSKLSNVKFKFINSNIKVIKGEKFTMRLQIINSSSSPLDLVVYYNNTINPIPSANNVRNSNGINNCGMNNGTIPNSPLTLENQYQLHNKYRKIAEGIILLSNDYKIPVVPPRETYFADLRFIGIMSGYYGTLSGLKVLDLNTNELIEVGNGASVLIQ

Entity 2 Entity 2 polymer

Description description	TRAPP-associated protein TCA17
Molecular weight formula_weight	17371.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MSLRPCFVSLIDESDKPILIYVPNEAENEMNDVLKYNVLSNISLDYFESALVEWHSLDSKPLLKSIFQLEGVSVFAMLIKQTGLKIVIGFEQKSLSGADDEFEAINQIFETVRKIYIRVKCNPLLVSGDEKSIIKSLERKFDELFISTEVEL

Entity 3 Entity 3 polymer

Description description	Trafficking protein particle complex subunit 33
Molecular weight formula_weight	30786.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MSSTHSNNVGHPQSSPQGPLTEQQRAQQQYQIFENSLPKVSQSVYQMLLNEMVPLAMGIERQISGDVISSDSNVTSENGNINNMIKRLKIEEHHTVDIIRSHNLIHELYKADEEEKEKVLARLRNIGFQIGLKLSELLIFSNNPNLKFKEMDLLLIMKFICRDVWKQIFGKQIDNLKTNHRGTFYLLDYDYRPIQSFSLEEDAKNEELKMIEPFLEIPVGIIRGVLSSLGYSSEEVICLASFIDRPTDRPKTAFPKGVSFHVQVTMPQ

Entity 4 Entity 4 polymer

Description description	Trafficking protein particle complex subunit BET3
Molecular weight formula_weight	22152.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,I,f,i

MVSTTQSRSLKAMGEEIWKNKTEKINTELFTLTYGSIVAQLCQDYERDFNKVNDHLYSMGYNIGCRLIEDFLARTALPRCENLVKTSEVLSKCAFKIFLNITPNITNWSHNKDTFSLILDENPLADFVELPMDAMKSLWYSNILCGVLKGSLEMVQLDCDVWFVSDILRGDSQTEIKVKLNRILKDEIPIGED

Entity 5 Entity 5 polymer

Description description	Trafficking protein particle complex subunit BET5
Molecular weight formula_weight	18453.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,g

MGIYSFWIFDRHCNCIFDREWTLASNSASGTINSKQNEEDAKLLYGMIFSLRSITQKLSKGSVKNDIRSISTGKYRVHTYCTASGLWFVLLSDFKQQSYTQVLQYIYSHIYVKYVSNNLLSPYDFAENENEMRGQGTRKITNRNFISVLESFLAPMVNQ

Entity 6 Entity 6 polymer

Description description	Trafficking protein particle complex subunit 23
Molecular weight formula_weight	24889.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

MAIETILVINKSGGLIYQRNFTNDEQKLNSNEYLILASTLHGVFAIASQLTPKALQLTQQTNIENTIPYIPYVGMSSNRSDTRNGGGNNNKHTNNEKLGSFKGDDFFKEPFTNWNKSGLRQLCTDQFTMFIYQTLTGLKFVAISSSVMPQRQPTIATTDKPDRPKSTSNLAIQIADNFLRKVYCLYSDYVMKDPSYSMEMPIRSNLFDEKVKKMVENLQ

Entity 7 Entity 7 polymer

Description description	Trafficking protein particle complex subunit 31
Molecular weight formula_weight	31755.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MSQRIIQPSASDQQFPGKSDGYEYTVGPKQAITSEASTTYIPSRIYSESLLFKRQEASLSAMAFLFQEMISQLHRTCKTAGDFETKLSDYGHNIGIRLLELLNFRASVSPSSLPRASAFLSQNESSSKLSNASNSPGMLANSSTATSASANERLQEKQTESLSNYITKMRRRDLKILDILQFIHGTLWSYLFNHVSDDLVKSSERDNEYMIVDNFPTLTQFIPGENVSCEYFVCGIIKGFLFNAGFPCGVTAHRMPQGGHSQRTVYLIQFDRQVLDREGLRFG

Entity 8 Entity 8 polymer

Description description	Trafficking protein particle complex subunit 20
Molecular weight formula_weight	19721.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

MPQYFAIIGKKDNPVYEIEFTNAENPQGFPQDLKELNPFILHASLDIVEDLQWQINPTSQLNGNGGNGSNGGGGFLRSRAVNNTDNCYLGKVDHFYGLAITAYISYSGMKFVMIHGNSANSSVVIDDNNMRSFYQEVHELYVKTLMNPFYKITDPIRSPAFDSRVRTLARKHLSK

Entity 9 Entity 9 polymer

Description description	GTP-binding protein YPT32/YPT11
Molecular weight formula_weight	25309.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNHHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21

Entity 10 Entity 10 polymer

Description description	Trafficking protein particle complex II-specific subunit 130
Molecular weight formula_weight	128424.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

MDKEIYCGSVPVSYFDPFDLFESLRPEFQQILPLDNIHWKAFDGTVRTVNRLPIELIPEGRGEADKSNDEQPFIRFLIVNCISIDQYRAKVRPLVRQWLPNLESVSSSTGEKMIYKPIILLYANSEVVDSNLFKSVSLMEKFGKDFPHVQTLEVRSVYRSPKERQEFWNQFSQKIKASVLSIFQKRLTHLQHSLANLQKGNNFEEQLLTREKLYELYVVFNILEDASLELQKIKKEILRRNMNMPDGKLQVPFESSSKSDESLGSIIIEGTLDKFQLHKYFFIRRLRLLKLEDQTLTAFVGAFQLIKNFIESISIEYRKSVRLLEFKHYFITSMLSYFEFENVSNPLLCEIKAELLMLKRDNWVQGVMATSGYRLMDKNYPNSDVKYKFDLLKETFVDETVFQENFLTLTKEILSLFNKCEGKRQRIVDILSIEIGLLYYQGKKYEEAVSLFLSCYEYYTQTNWNSIGLKILQVFIDSLSHCPKLDVLQIDGESVSASAVLTNAFLNILKLCKDNDSKEIWWKKFMDLQMKNNIHLMYPLDGLFEVTLNSKVHLARANVSAIEVNLKSYGFPEDISTKTMRLSLKNMGGDVIVFGASDFLLKKGENKLILECRDIMYGEFSLLSFEIIVEGITFVKEFPENQDEFIVVPEIYCKESTKVLVKQAHNLNLGEYALELKSVQSDALESLQVEVEVQKNIGNMKNLPVSFSMDEIQARKRYNTPFENVRLEYYLLDQITAFDLIIKTSFTKKNDQGTFGETKKVRIQCYLQLSVSVEDIFKKDIFFFKFLLNSSVREEPVILYSSELSAPDTRNDYNIRGDYIATTPALITFDGNESFINCYEITANNNFDSKDIFNLKVRYNTLKEQLDCFITDAVLIEGDVEWFILFEKWKTFWELEILKKLKYDYDAFKENRIIRLLKTSIDLNKTKSKIRNLCIEKAVLDKILICLNKVSRGIAVCNTDMDEYVRNLVPKQLTVPVQLPGFEQFFHVQFEQMETSHDALHDTIATIGNSLSYTVIVENLSGQWGQDVIDDGGYIFEILSSNEWLIHGQKRCAIKEKRKEFEVHLIPLKKGYLNFPRVEITNINGKSCRVDHSNAFESILIFAA

Entity 11 Entity 11 polymer

Description description	Trafficking protein particle complex II-specific subunit 120
Molecular weight formula_weight	147823.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a

MNILKHFPSYVGPSKIRTLVIPIGHWTRKEFNNAVQKLSEFNEIHLSDVTPIDSPIFTPQGFPHGKLFFDFLTIDHDDALELFLYDFEPFRKTFVIIGLVNDYSDPLTNLNFMKEKYPTLISPNLVYASSTPTKELEQTIDTMENVFASSPDMQKNIETIMCDIARNFLTALNSYYSSYKHVTLRSPGAIGGNAVLKTTLIRQNSYTSSSSSTPMSAVQSSVSSSSKAGSVTTASKRLSSFEMTTNSLKRSASLKLATTLSTSENRSQQKSLGRQMKILGNFQLLAGRYVDALNSFVDAITTLYKVRDYLWLGSALDGISICFLLLSYLGLSYQIPQIVSLICPVEKLNFESSSTGISPVDSNSKATASTTASSTPRNSISIAAMQSPRNSIMSLSAPALNIDVENINLPLLIKCISDKVLYYYDLSLMHNSEYAPQVVYCEFLLKTLTFMTSCYKSSEFSKDVLDNIVKNQHRALSDIPNSPMFPRFEVYFYSNKLFELQLKEMQVEAQIKIYSTMAEVYRLLGYKRKQLFVLRLLMVALLATPNKIAWHPDYRTLIDTIIELLNINESEAKINVDDPSQSTWLILQKKILQLCIKVSRKINDFEYVAKFSSILITKYTHLLNQSEQDALFKEYIQPSITNESITSYWDPFILREVVINRILDSDPTSNEIPLESDVSSLESLENRQKTQDINPQEVFNPFKRVQPTSFVSNNSTKVPILVFLVGDKAEFTCRVQNPFKFDFTINDIQLDEEISEFCEIDRKAVSYSGPYNVKAESIRSITLPLIIKKPTYKKIYEISCLKISILKLPLQKFDIINDSRRSNPVEEEAEYSKCIYGKLKIKILPEQPQLELLSTSKMTRNSWMMLDGTKTDFHITVRNKSLSCAINHIKIIPMNNIEQMLKPDYWKKMPPDDLYIMEKQLDWLSKSCVRIIKLPTVIKPNETITFDLELDNTAVPFNFTGFDLLIEYGMSATDESCIYLKKLSIPYEVTLRRTIEVPSMDIIPLNELFSSQVENVDWIEYVMSKIRAESNLHSRDFILLLLDFRNSWIDGIKLNVQFEDFTSNEYHVEASHTSRIIVPIKKIDYKKYNFENTPIPRIYPGRQFIQSGLNEEQTIEMRQKFWCREHIISKLKCNWKLTTDQSVTGSVDFNKFIEKFDHKMVYTIYPGRLFYGVQLLLDEPKVKVGEIINLKIITEPTSTCRRKQNSTVNFLDIVIFDSKTSKILPRSNRRILYNGSLTKPISTTKVSEINLEIIPIEKGRYEFSVCISKSNNQDGIIQFDSENVILSVI

Entity 12 Entity 12 polymer

Description description	Trafficking protein particle complex II-specific subunit 130
Molecular weight formula_weight	24953.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 13 Entity 13 polymer

Description description	Trafficking protein particle complex II-specific subunit 65
Molecular weight formula_weight	17890.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n,N

Entity 14 Entity 14 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	149906

Structure of the yeast TRAPPII-Rab11/Ypt32 complex in the closed/open state (composite structure)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Trafficking protein particle complex II-specific subunit 65

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TRAPP-associated protein TCA17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit 33

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit BET3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit BET5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit 23

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit 31

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex subunit 20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

GTP-binding protein YPT32/YPT11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Trafficking protein particle complex II-specific subunit 130

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer