7ujj

Stx2a and DARPin complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Shiga-like toxin 2 subunit A

Escherichia phage 933W

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	DARPin × 1 Shiga-like toxin 2 subunit B × 5 （P09386） 3-PYRIDINIUM-1-YLPROPANE-1-SULFONATE × 4 FORMIC ACID × 15 SODIUM ION × 5 1,2-ETHANEDIOL × 5 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STXA_BP933
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–297； UniProt 23–319

Shiga-like toxin 2 subunit B

Escherichia phage 933W

UniProt P09386

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	DARPin × 1 Shiga-like toxin 2 subunit A × 1 （P09385） 3-PYRIDINIUM-1-YLPROPANE-1-SULFONATE × 4 FORMIC ACID × 15 SODIUM ION × 5 1,2-ETHANEDIOL × 5 water × 7	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STXB_BP933
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–70； UniProt 20–89 Author chain C； PDBConstruct 1–70； UniProt 20–89 Author chain D； PDBConstruct 1–70； UniProt 20–89 Author chain E； PDBConstruct 1–70； UniProt 20–89 Author chain F； PDBConstruct 1–70； UniProt 20–89

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ujj
Deposition date deposition_date	2022-03-30
Structure title title	Stx2a and DARPin complex
Keywords keywords	DARPin, shiga toxin, ANTITOXIN; ANTITOXIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ujj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ujj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ujj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.52 Å
Rg (electron density)	30.19 Å
Total Rg	30.67 Å
Atom count	7869
Residues	816
Excluded volume	114340 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ujj__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	DARPin
Molecular weight formula_weight	19863.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G
Atom count atom_count	8403

GKKLLEAARAGQDDEVRILMANGADVNACDSNGRTPLHLAAVRGHLEIVEVLLKNGADVNAWDVIGKTPLHLAADGGHLEIVEVLLKNGADVNAWDLIGRTPLHLAALDGHLEIVEVLLEHGADVNAYDRPGHTPLHLAARRGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQ

Source Source

Source organism organism	Synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 2 Entity 2 polymer

Description description	Shiga-like toxin 2 subunit A
Molecular weight formula_weight	33228.2 kDa
EC 编号 ec_number	3.2.2.22
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

REFTIDFSTQQSYVSSLNSIRTEISTPLEHISQGTTSVSVINHTPPGSYFAVDIRGLDVYQARFDHLRLIIEQNNLYVAGFVNTATNTFYRFSDFTHISVPGVTTVSMTTDSSYTTLQRVAALERSGMQISRHSLVSSYLALMEFSGNTMTRDASRAVLRFVTVTAEALRFRQIQREFRQALSETAPVYTMTPGDVDLTLNWGRISNVLPEYRGEDGVRVGRISFNNISAILGTVAVILNCHHQGARSVRAVNEESQPECQITGDRPVIKINNTLWESNTAAAFLNRKSQFLYTTGK

Source Source

Source organism organism	Escherichia phage 933W
Common name common_name	Bacteriophage 933W
NCBI taxonomy ID ncbi_taxonomy_id	10730
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 3 Entity 3 polymer

Description description	Shiga-like toxin 2 subunit B
Molecular weight formula_weight	7824.6 kDa
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C,D,E,F

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Source Source

Source organism organism	Escherichia phage 933W
Common name common_name	Bacteriophage 933W
NCBI taxonomy ID ncbi_taxonomy_id	10730
Host organism host_organism	Escherichia coli-Pichia pastoris shuttle vector pPpARG4

Entity 4 Entity 4 non-polymer

Description description	3-PYRIDINIUM-1-YLPROPANE-1-SULFONATE
Molecular weight formula_weight	201.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	FORMIC ACID
Molecular weight formula_weight	46.0 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 6 Entity 6 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 7 Entity 7 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	511

▶

Resolution resolution	6.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	108744

Stx2a and DARPin complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Shiga-like toxin 2 subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Shiga-like toxin 2 subunit B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ujj__assembly_1__model_1

7ujj__assembly_1__model_1 | I(q)

7ujj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)

Stx2a and DARPin complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Shiga-like toxin 2 subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Shiga-like toxin 2 subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ujj__assembly_1__model_1

7ujj__assembly_1__model_1 | I(q)

7ujj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (1)