SAXSdb — 7w8l

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cobalt-containing nitrile hydratase subunit beta

Pseudonocardia thermophila DSM 43832

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Nitrile hydratase × 2 （A0A1M6Q338） COBALT (II) ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NHAB_PSETH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–233； UniProt 1–233

Nitrile hydratase

Pseudonocardia thermophila DSM 43832

UniProt A0A1M6Q338

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Cobalt-containing nitrile hydratase subunit beta × 2 （Q7SID3） COBALT (II) ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1M6Q338_PSETH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–205； UniProt 1–205

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7w8l
Deposition date deposition_date	2021-12-08
Structure title title	Crystal Structure of Co-type nitrile hydratase mutant from Pseudonocardia thermophila - M46R
Keywords keywords	hydration, catalyze the hydration of nitriles to form amides, LYASE; LYASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7w8l__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7w8l__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7w8l__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.95 Å
Rg (electron density)	29.23 Å
Total Rg	29.92 Å
Atom count	6902
Residues	852
Excluded volume	122030 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7w8l__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Cobalt-containing nitrile hydratase subunit beta
Molecular weight formula_weight	26609.6 kDa
EC 编号 ec_number	4.2.1.84
Mutation mutation	M46R
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	3651

MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFRGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDTKAAAA

Source Source

Source organism organism	Pseudonocardia thermophila DSM 43832
NCBI taxonomy ID ncbi_taxonomy_id	1123026
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Nitrile hydratase
Molecular weight formula_weight	23290.7 kDa
EC 编号 ec_number	4.2.1.84
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MTENILRKSDEEIQKEITARVKALESMLIEQGILTTSMIDRMAEIYENEVGPHLGAKVVVKAWTDPEFKKRLLADGTEACKELGIGGLQGEDMMWVENTDEVHHVVVCTLCSCYPWPVLGLPPNWFKEPQYRSRVVREPRQLLKEEFGFEVPPSKEIKVWDSSSEMRFVVLPQRPAGTDGWSEEELATLVTRESMIGVEPAKAVA

Source Source

Source organism organism	Pseudonocardia thermophila DSM 43832
NCBI taxonomy ID ncbi_taxonomy_id	1123026
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	COBALT (II) ION
Molecular weight formula_weight	58.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	197

▶

Unit-cell length a length_a	65.461 Å
Unit-cell length b length_b	65.461 Å
Unit-cell length c length_c	182.805 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	2.301 Å
Low-resolution limit resolution_low	24.090 Å
R factor r_factor	0.1825
R_work r_work	0.1798
R_free r_free	0.2333

Crystal Structure of Co-type nitrile hydratase mutant from Pseudonocardia thermophila - M46R

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cobalt-containing nitrile hydratase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Nitrile hydratase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7w8l__assembly_1__model_1

7w8l__assembly_1__model_1 | I(q)

7w8l__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (2)

Crystal Structure of Co-type nitrile hydratase mutant from Pseudonocardia thermophila - M46R

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cobalt-containing nitrile hydratase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nitrile hydratase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7w8l__assembly_1__model_1

7w8l__assembly_1__model_1 | I(q)

7w8l__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (2)