7wff

Subcomplexes B,M and L in the Cylic electron transfer supercomplex NDH-PSI from Arabidopsis

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1C_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–360； UniProt 1–360

NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic

OrganismNot specified

UniProt A0A1B1W4Z4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1B1W4Z4_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–512； UniProt 1–512

NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic

OrganismNot specified

UniProt P56751

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3C_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–120； UniProt 1–120

NAD(P)H-quinone oxidoreductase chain 4, chloroplastic

OrganismNot specified

UniProt A0A1B1W4Z0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1B1W4Z0_ARATH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–506； UniProt 1–506

NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

OrganismNot specified

UniProt P26289

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LC_ARATH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–101； UniProt 1–101

NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic

OrganismNot specified

UniProt P56752

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5C_ARATH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–746； UniProt 1–746

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

OrganismNot specified

UniProt Q95695

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6C_ARATH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–176； UniProt 1–176

Photosynthetic NDH subunit of subcomplex B 1, chloroplastic

OrganismNot specified

UniProt Q9S9N6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PNSB1_ARATH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain a； PDBConstruct 1–461； UniProt 1–461

Photosynthetic NDH subunit of subcomplex B 2, chloroplastic

OrganismNot specified

UniProt Q94AQ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PNSB2_ARATH
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain b； PDBConstruct 1–348； UniProt 1–348

Photosynthetic NDH subunit of subcomplex B 3, chloroplastic

OrganismNot specified

UniProt Q9LU21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PNSB3_ARATH
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain c； PDBConstruct 1–204； UniProt 1–204

NDH dependent flow 6

OrganismNot specified

UniProt B3H6Z4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B3H6Z4_ARATH
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain d； PDBConstruct 1–161； UniProt 1–161

Photosynthetic NDH subunit of subcomplex B 5, chloroplastic

OrganismNot specified

UniProt Q9FG89

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PNSB5_ARATH
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain e； PDBConstruct 1–212； UniProt 1–212

Photosynthetic NDH subunit of lumenal location 1, chloroplastic

OrganismNot specified

UniProt O80634

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PNSL1_ARATH
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain f； PDBConstruct 1–238； UniProt 1–238

Photosynthetic NDH subunit of lumenal location 2, chloroplastic

OrganismNot specified

UniProt Q9XI73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PNSL2_ARATH
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain g； PDBConstruct 1–190； UniProt 1–190

Photosynthetic NDH subunit of lumenal location 3, chloroplastic

OrganismNot specified

UniProt Q9SGH4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PNSL3_ARATH
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain h； PDBConstruct 1–220； UniProt 1–220

Photosynthetic NDH subunit of lumenal location 4, chloroplastic

OrganismNot specified

UniProt Q9SCY3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic × 1 （Q9ASS6） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PNSL4_ARATH
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain i； PDBConstruct 1–217； UniProt 1–217

Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic

OrganismNot specified

UniProt Q9ASS6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic × 1 （Q37165） NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic × 1 （A0A1B1W4Z4） NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic × 1 （P56751） NAD(P)H-quinone oxidoreductase chain 4, chloroplastic × 1 （A0A1B1W4Z0） NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic × 1 （P26289） NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic × 1 （P56752） NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic × 1 （Q95695） Photosynthetic NDH subunit of subcomplex B 1, chloroplastic × 1 （Q9S9N6） Photosynthetic NDH subunit of subcomplex B 2, chloroplastic × 1 （Q94AQ8） Photosynthetic NDH subunit of subcomplex B 3, chloroplastic × 1 （Q9LU21） NDH dependent flow 6 × 1 （B3H6Z4） Photosynthetic NDH subunit of subcomplex B 5, chloroplastic × 1 （Q9FG89） Photosynthetic NDH subunit of lumenal location 1, chloroplastic × 1 （O80634） Photosynthetic NDH subunit of lumenal location 2, chloroplastic × 1 （Q9XI73） Photosynthetic NDH subunit of lumenal location 3, chloroplastic × 1 （Q9SGH4） Photosynthetic NDH subunit of lumenal location 4, chloroplastic × 1 （Q9SCY3） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PNSL5_ARATH
Isoform	Q9ASS6-2
PDB entities	17
Chains and sequence ranges	Author chain j； PDBConstruct 1–255； UniProt 1–255

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7wff
Deposition date deposition_date	2021-12-26
Structure title title	Subcomplexes B,M and L in the Cylic electron transfer supercomplex NDH-PSI from Arabidopsis
Keywords keywords	Subcomplex B, subcomplex M, subcomplex L, Arabidopisis, plant, cyclic electron transport supercomplex, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7wff__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7wff__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7wff__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.31 Å
Rg (electron density)	60.60 Å
Total Rg	60.47 Å
Atom count	32124
Residues	4065
Excluded volume	582830 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7wff__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic
Molecular weight formula_weight	40041.9 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	32124

MIIYATAVQTINSFVKLESLKEVYGLIWIFVPIFSLVLGIITGVLVIVWLEREISAGIQQRIGPEYAGPLGILQALADGTKLLFKENLRPSRGNTPLFSIGPSIAVISILLSYSVIPFSNHLVLADLNIGIFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVLSISLLSNSLSTVDIVEAQSKYGFWGWNLWRQPIGFIIFLISSLAECERLPFDLPEAEEELIAGYQTEYSGIKFGLFYVASYLNLLISSLFVTVLYLGGWNISIPYISILELFQRDQIFGTTIGIFITLAKTYLFLFVSIATRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSFQLFSL

Entity 2 Entity 2 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic
Molecular weight formula_weight	57018.6 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MIWHVQNENFILDSTRIFMKAFHLLLFDGSFIFPECILIFGLILLLMIDSTSDQKDIPWLYFISSTSFVMSITALLFRWREEPMISFSGNFQTNNFNEIFQFLILLCSTLCIPLSVEYIECTEMAITEFLLFILTATLGGMFLCGANDLITIFVAPECFSLCSYLLSGYTKKDIRSNEATMKYLLMGGASSSILVHGFSWLYGSSGGEIELQEIVNGLINTQMYNSPGISIALIFITVGIGFKLSLAPSHQWTPDVYEDSPTPVVAFLSVTSKVAASASATRIFDIPFYFSSNEWHLLLEILAILSMIFGNLIAITQTSMKRMLAYSSIGQIGYVIIGIIVGDSNGGYASMITYMLFYIAMNLGTFACIILFGLRTGTDNIRDYAGLYTKDPFLALSLALCLLSLGGLPPLAGFFGKLHLFWCGWQAGLYFLVSIGLLTSVLSIYYYLKIIKLLMTGRNQEITPHMRNYRISPLRSNNSIELSMIVCVIASTIPGISMNPIIAIAQDTLFSF

Entity 3 Entity 3 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic
Molecular weight formula_weight	13846.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MFLLYEYDIFWAFLLISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEWS

Entity 4 Entity 4 polymer

Description description	NAD(P)H-quinone oxidoreductase chain 4, chloroplastic
Molecular weight formula_weight	56992.5 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MYLVFTTNDFPWLTIIVVFPISAGSLMLFLPHRGNKVNKWYTICICILELLLTTYAFCYNFKMDDPLIQLSEDYKWIDFFDFYWRMGIDGLSIGTILLTGFITTLATLAAFPVTRDSRFFHFLMLAMYSGQIGSFSSRDLLLFFIMWELELIPVYLLLSMWGGKKRLYSATKFILYTAGSSIFLLIGVLGISLYGSNEPTLNLELLANKSYPVTLEILFYIGFLIAFAVKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSMFSPWLLVVGTIQIIYAASTSPGQRNLKKRIAYSSVSHMGFIIIGISSITDPGLNGAILQIISHGFIGAALFFLAGTSYDRIRLVYLDEMGGMAISIPKIFTMFTILSMASLALPGMSGFIAEFIVFFGIITSQKYFLISKIFIIFVMAIGMILTPIYLLSMLRQMFYGYKLINIKNFSFFDSGPRELFLSISILLPIIGIGIYPDFVLSLASDKVESILSNYFYG

Entity 5 Entity 5 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic
Molecular weight formula_weight	11297.4 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MILEHVLVLSAYLFLIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGEIFCIFVIAIAAAEAAIGLAIVSSIYRNRKSIRINQSTLLNK

Entity 6 Entity 6 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic
Molecular weight formula_weight	85300.8 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MEHTYQYSWIIPFIPLPVPILLGVGLLLFPTATKNLRRMWTFLSIFLLSIVMIFSIYLSIQQIFLSCIHQNVWSWTINNEFSFEFGYFIDPLTSIMSILITTVGILVLIYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFGLLLGILGLYWITGSFEFQDLFEIFNNLILNNRVNLLFLTLCAFLLFVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPSIMYIISLIGIITVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLIGTLSLCGIPPLACFWSKDEILNDSLLFSPIFAIIACSTAGLTAFYMFRIYLLTFEGHLNTYFLNYSGKKSGSFYSLSLWGKEEEKKLNKNFGLVPLLTMNNTKRASFFCNKTYKISNNVRNQIFITVENFGLNTRTFYYPHESDNTILFPMLILVLFTLFIGAIGIPFNQEGIDFDILSKFFTPSINLLHKNSQNFVDWYEFLRNATFSVSIAFFGIFIAYCLYKPFYSSLLNLTLLNSFQKWNSKRIHWEKLINFVYNWSYNRGYIDSFFKTSLIESIRRLAKQTTFFDKRIIDGITNGVGITSFFVGEVTKYIGGSRISSYLFLYLSYVLIFLMILFFFYFEKF

Entity 7 Entity 7 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic
Molecular weight formula_weight	19218.6 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILSNSHFVAAAQLLIYVGAINVLIIFAVMFMNDSEYSTDFNLWTIGNGITSLVCTTILFLLMSTILDTSWYGVIWTTKLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ

Entity 8 Entity 8 polymer

Description description	Photosynthetic NDH subunit of subcomplex B 1, chloroplastic
Molecular weight formula_weight	51080.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MASSLPLLPKPISPFFKTPPFSTSKPLVFLNFQTRLTSRSSDVSVNLKKKNNPWLDPFDSGEDPDNEYGSLFADGKQDEDPRPPDNPDNPYGFLKFPKGYTVELASLPLKIRGDVRRCCCVISGGVYENLLFFPTIQLIKDRYPGVQVDILTTERGKQTYELNKNVRWANVYDPDDHWPEPAEYTDMIGLLKGRYYDMVLSTKLAGLGHAAFLFMTTARDRVSYIYPNVNSAGAGLMLSETFTAENTNLSELGYSMYTQMEDWLGRPFRSVPRTPLLPLRVSISRKVKEVVAAKYRNAGAVTGKFIVIHGIESDSKASMQSKGDADSLLSLEKWAKIIKGVRGFKPVFVIPHEKERENVEDFVGDDTSIVFITTPGQLAALINDSAGVIATNTAAIQLANARDKPCIGLFSSEEKGKLFVPYAEEKSNCVIIASKTGKLADIDIGTVKNAMQVFEGSLALV

Entity 9 Entity 9 polymer

Description description	Photosynthetic NDH subunit of subcomplex B 2, chloroplastic
Molecular weight formula_weight	38048.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MASLISFSLLPKPKAVRSSISAPQTQTINTEKLEDKFGRKGIKFSESNNIPMVELKVRNGSSLKLSLSDAHVLSYKPKVYWKDEGFEEVLYTVDGDESRGGVGVVIVNGEEPKGGSSVISGCDWSVKDTDSDAIDALQIELSCTAGVLDITYIVSLYPVSMATALVVKNNGRKPVTLKPGIMSYLRFKKRSGAGIQGLKGCSYCPNPPLSSPFELLSPSEAMKAESSGWFGSEEGEKPGIWAVEDSVITLLEKKMSRIYGAPPAERLKAVYNTPPSKFETIDQGRGLFFRMIRIGFEEMYVGSPGSMWDKYGKQHYFVCTGPTSMLVPVDVASGETWRGAMVIEHDNL

Entity 10 Entity 10 polymer

Description description	Photosynthetic NDH subunit of subcomplex B 3, chloroplastic
Molecular weight formula_weight	22448.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MGSVQLSGSGLVASLPPNHSFSHKTKLNKPNSYFFRSKHNAARTKTVRAISTAPASQPPAADEPDEPPAVDFAFVHSVLLPDGTPDVHWRRANGGQKLRDIMLDSNIELYGPYSKPLSNCAGVGTCATCMVEIVNGKELLNPRTDIEKEKLKRKPKNWRLACQTNVGNPDSTGLVVIQQLPEWKAHEWNIPKNIPNDDDLETST

Entity 11 Entity 11 polymer

Description description	NDH dependent flow 6
Molecular weight formula_weight	18699.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MAEAFTSFTFTNLHIPSSYNHSPKQNSGPNHGYWLSNVNEKRERNLMRGSLCVRKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKDPFYDSEEYRGDGGDGTGYWVYETVCISPFLILLGKKEKNLEMHTNYN

Entity 12 Entity 12 polymer

Description description	Photosynthetic NDH subunit of subcomplex B 5, chloroplastic
Molecular weight formula_weight	23767.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MATVTILSPKSIPKVTDSKFGARVSDQIVNVVKCGKSGRRLKLAKLVSAAGLSQIEPDINEDPIGQFETNSIEMEDFKYGYYDGAHTYYEGEVQKGTFWGAIADDIAAVDQTNGFQGLISCMFLPAIALGMYFDAPGEYLFIGAALFTVVFCIIEMDKPDQPHNFEPQIYKLERGARDKLINDYNTMSIWDFNDKYGDVWDFTIEKDDIATR

Entity 13 Entity 13 polymer

Description description	Photosynthetic NDH subunit of lumenal location 1, chloroplastic
Molecular weight formula_weight	26997.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MAVSSLSIRCGGFSPTISHKTEILCPNPSLKACCLLSSGGKADSSESTYQKGSGNNWKRRQALVGVGTLVATSIPATLLLAEEIPKSYSPFVDREDGYSYYYPSDWREFDFRAHDSAFKDRYLQLQNVRVRFIPTEKNDIHEVGPMEEVVYDLVKHKFAAPNQVATIYDMKERVEDGKNYYTFEYGLRTPIYATTSFATVAVGNNRYYTLIVGANERRWRKVKKQLQVVADSLKILQI

Entity 14 Entity 14 polymer

Description description	Photosynthetic NDH subunit of lumenal location 2, chloroplastic
Molecular weight formula_weight	22183.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MSSFTTTNTPPPYLLRKIYHRRVNQPFSVVCCTGEPQQDIFTRRRTLTSLITFTVIGGATSSALAQEKWGTRSFIKEKYFMPGLSPEDAAARIKQTAEGLRDMREMLDHMSWRYVIFYIRLKQAYLSQDLTNAMNILPESRRNDYVQAANELVENMSELDFYVRTPKVYESYLYYEKTLKSIDNVVEFLA

Entity 15 Entity 15 polymer

Description description	Photosynthetic NDH subunit of lumenal location 3, chloroplastic
Molecular weight formula_weight	24811.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MAHFIDLNSLTNTLPSLPKLPESRKTGKSSGFACRRTEEFQEPDSVQITRRMTLGFAVSIGLTGILGENNVSLAQDNGFWIDGPLPIPPIYNNIVNEKTGTRTFIKKGVYVADIGTKGRMYRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISAAASEDKQPLTDLANRLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTRMA

Entity 16 Entity 16 polymer

Description description	Photosynthetic NDH subunit of lumenal location 4, chloroplastic
Molecular weight formula_weight	23282.5 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MAISTLTLTQSLYTRSFRPTIFFSSSSSSSFSCLCSSSSDCEPKLSVKKRVFGVGLGFLASSILSLTPLDADATRIDYYATVGDPLCEYSYAKSGLGFCDLDVGFGDEAPRGVLVNIHYTARFADGTLFDSSYKRARPLTMRIGVGKVIRGLDQGILGGEGVPPMRVGGKRKLQIPPKLAYGPEPAGCFSGDCNIPGNATLLYDINFVEIYPGSNTR

Entity 17 Entity 17 polymer

Description description	Isoform 2 of Photosynthetic NDH subunit of lumenal location 5, chloroplastic
Molecular weight formula_weight	27915.6 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MATLSMTLSLSAPPRRLSPINTSAFTSTSFRLRTKSSFDSISFSSSTPFSASSLLLHTSYTKRNHRCFSVQSNAEVVTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGSTFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQFFICTIKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPMSEA

Entity 18 Entity 18 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 20 Entity 20 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	7wffC01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1610 — NADH:ubiquinone/plastoquinone oxidoreductase, chain 3

Domain ID domain_id	7wffE01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3510 —

Domain ID domain_id	7wffG01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1200 — NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ

Domain ID domain_id	7wffb01
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	98 — Beta-galactosidase; Chain A, domain 5
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.59 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	136022

Subcomplexes B,M and L in the Cylic electron transfer supercomplex NDH-PSI from Arabidopsis

1. Protein Identity and Related Structures Protein Identity & Related Structures

NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase chain 4, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of subcomplex B 1, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of subcomplex B 2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic NDH subunit of subcomplex B 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer