7yol

Crystal structure of tetra mutant (D67E, A68P, L98I, A301S) of O-acetylserine sulfhydrylase from Haemophilus influenzae in complex with high-affinity inhibitory peptide of serine acetyltransferase from Haemophilus influenzae at 2.4 A

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cysteine synthase

Haemophilus influenzae Rd KW20

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Peptide from Serine acetyltransferase × 2 （P43886） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYSK_HAEIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–316； UniProt 1–316

Peptide from Serine acetyltransferase

OrganismNot specified

UniProt P43886

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Cysteine synthase × 2 （P45040） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYSE_HAEIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–7； UniProt 261–267

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7yol
Deposition date deposition_date	2022-08-01
Structure title title	Crystal structure of tetra mutant (D67E, A68P, L98I, A301S) of O-acetylserine sulfhydrylase from Haemophilus influenzae in complex with high-affinity inhibitory peptide of serine acetyltransferase from Haemophilus influenzae at 2.4 A
Keywords keywords	;Tetra mutant (D67E, A68P, L98I, A301S), O-acetylserine sulfhydrylase, Haemophilus influenzae, high-affinity inhibitory peptide of serine acetyltransferase, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex ;; TRANSFERASE/TRANSFERASE INHIBITOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7yol__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7yol__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7yol__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.20 Å
Rg (electron density)	24.20 Å
Total Rg	25.08 Å
Atom count	4670
Residues	622
Excluded volume	83770 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7yol__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Cysteine synthase
Molecular weight formula_weight	33707.5 kDa
EC 编号 ec_number	2.5.1.47
Mutation mutation	D67E, A68P, L98I, A301S
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2393

MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMVWQAEKDGTLTKGKEIVEPTSGNTGIALAYVAAARGYKITLTMPETMSIERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSSSERYLSTALFEGIEG

Source Source

Source organism organism	Haemophilus influenzae Rd KW20
NCBI taxonomy ID ncbi_taxonomy_id	71421
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Peptide from Serine acetyltransferase
Molecular weight formula_weight	775.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

DGMNLNI

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	58

▶

Unit-cell length a length_a	112.370 Å
Unit-cell length b length_b	112.370 Å
Unit-cell length c length_c	45.700 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	I 41
Space-group number int_tables_number	80
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	42.330 Å
R factor r_factor	—
R_work r_work	0.1679
R_free r_free	0.1968

Crystal structure of tetra mutant (D67E, A68P, L98I, A301S) of O-acetylserine sulfhydrylase from Haemophilus influenzae in complex with high-affinity inhibitory peptide of serine acetyltransferase from Haemophilus influenzae at 2.4 A

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cysteine synthase

State in the Current Structure

Other States of the Same Protein in the Database

Peptide from Serine acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7yol__assembly_1__model_1

7yol__assembly_1__model_1 | I(q)

7yol__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of tetra mutant (D67E, A68P, L98I, A301S) of O-acetylserine sulfhydrylase from Haemophilus influenzae in complex with high-affinity inhibitory peptide of serine acetyltransferase from Haemophilus influenzae at 2.4 A

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cysteine synthase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Peptide from Serine acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7yol__assembly_1__model_1

7yol__assembly_1__model_1 | I(q)

7yol__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)