8bw9

Cryo-EM structure of the RAF activating complex KSR-MEK-CNK-HYP

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein aveugle

Drosophila melanogaster

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Connector enhancer of KSR protein CNK × 1 （Q7KNQ9） Dual specificity mitogen-activated protein kinase kinase dSOR1 × 1 （Q24324） KSR × 1 （Q24170） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 Trametinib × 1 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AVE_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–110； UniProt 2–106

Connector enhancer of KSR protein CNK

Drosophila melanogaster

UniProt Q7KNQ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Protein aveugle × 1 （Q8ML92） Dual specificity mitogen-activated protein kinase kinase dSOR1 × 1 （Q24324） KSR × 1 （Q24170） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 Trametinib × 1 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7KNQ9_DROME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 6–335； UniProt 1–330

Dual specificity mitogen-activated protein kinase kinase dSOR1

Drosophila melanogaster

UniProt Q24324

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Protein aveugle × 1 （Q8ML92） Connector enhancer of KSR protein CNK × 1 （Q7KNQ9） KSR × 1 （Q24170） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 Trametinib × 1 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DSOR1_DROME
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–396； UniProt 1–396

KSR

Drosophila melanogaster

UniProt Q24170

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Protein aveugle × 1 （Q8ML92） Connector enhancer of KSR protein CNK × 1 （Q7KNQ9） Dual specificity mitogen-activated protein kinase kinase dSOR1 × 1 （Q24324） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 Trametinib × 1 MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q24170_DROME
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 4–316； UniProt 654–966

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8bw9
Deposition date deposition_date	2022-12-06
Structure title title	Cryo-EM structure of the RAF activating complex KSR-MEK-CNK-HYP
Keywords keywords	;Kinase suppressor of Ras (KSR), Dual specificity mitogen-activated protein kinase kinase (MEK), Connector enhancer of KSR (CNK), Protein Aveugle (AVE), Hyphen protein (HYP), protein complex, SIGNALING PROTEIN ;; SIGNALING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8bw9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8bw9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8bw9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.01 Å
Rg (electron density)	29.94 Å
Total Rg	30.75 Å
Atom count	6957
Residues	861
Excluded volume	124330 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8bw9__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Protein aveugle
Molecular weight formula_weight	13143.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	6957

GAMDPGEETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHCGEYTQYEQLFAQHDITGRALLRITDSSLQRMGVTDNRDREAIWREIVKQRLKTDIMEIRDMERLNIY

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Connector enhancer of KSR protein CNK
Molecular weight formula_weight	38534.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GAMDPMAYINIAEWTPDQVTDWIKGLDESMKGYLYEFSKQEIGGRALLNIRPYELENLGMLRIGHQEIVLEAVENLRNFHYHLKNDNLQFMALHVATAAKNLHRELARNHAESTKIDTRILHDITRTIATLKPLVGSLERTPFRKQEMYREYCGNVLKCGLELATIAHRDRFALQPVPAIRQSAERLENLANFVIQDISDPMVLQPASLNLVTLKKRESELGFNIESSYNGIHRVTDIKYNSPAHNSGKIEDGDEIVQINYQTVVGWQHRTVLEHLREALPDVVLTVKKRPKHTKMFGQIYMQPYRLPSKKRNMAARWAAQMPSPRAAFLTLDTE

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Dual specificity mitogen-activated protein kinase kinase dSOR1
Molecular weight formula_weight	43926.5 kDa
EC 编号 ec_number	2.7.12.2
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSKNKLNLVLPPVNTEATVAAATVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLDMGDTERKRIKMFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEESGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLSHPWIRKAELEEVDISGWVCKTMDLPPSTPKRNTSPN

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	KSR
Molecular weight formula_weight	36474.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

GGRTEDGDSGQWRQNSISLKEWDIPYGDLLLLERIGQGRFGTVHRALWHGDVAVKLLNEDYLQDEHMLETFRSEVANFKNTRHENLVLFMGACMNPPYLAIVTSLCKGNTLYTYIHQRREKFAMNRTLLIAQQIAQGMGYLHAREIIHKDLRTKNIFIENGKVIITDFGLFSSTKLLYCDMGLGVPHNWLCYLAPELIRALQPEKPRGECLEFTPYSDVYSFGTVWYELICGEFTFKDQPAESIIWQVGRGMKQSLANLQSGRDVKDLLMLCWTYEKEHRPQFARLLSLLEHLPKKRLARSPSHPVNLSRSAESVF

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	506.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	Trametinib
Molecular weight formula_weight	615.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.32 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	141531

Cryo-EM structure of the RAF activating complex KSR-MEK-CNK-HYP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein aveugle

State in the Current Structure

Other States of the Same Protein in the Database

Connector enhancer of KSR protein CNK

State in the Current Structure

Other States of the Same Protein in the Database

Dual specificity mitogen-activated protein kinase kinase dSOR1

State in the Current Structure

Other States of the Same Protein in the Database

KSR

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8bw9__assembly_1__model_1

8bw9__assembly_1__model_1 | I(q)

8bw9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)

Cryo-EM structure of the RAF activating complex KSR-MEK-CNK-HYP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein aveugle

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Connector enhancer of KSR protein CNK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dual specificity mitogen-activated protein kinase kinase dSOR1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

KSR

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8bw9__assembly_1__model_1

8bw9__assembly_1__model_1 | I(q)

8bw9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)