SAXSdb — 8cm0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunity protein RhsI2

Serratia marcescens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Rhs-family protein × 1 （A0ABC9II69） 1,2-ETHANEDIOL × 1 ACETATE ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0ABF7SXG6_SERMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–162； UniProt 1–162

Rhs-family protein

Serratia marcescens

UniProt A0ABC9II69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Immunity protein RhsI2 × 1 （A0ABF7SXG6） 1,2-ETHANEDIOL × 1 ACETATE ION × 3 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0ABC9II69_SERMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 22–162； UniProt 1290–1430

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8cm0
Deposition date deposition_date	2023-02-17
Structure title title	Rhs2-CT endonuclease toxin in complex with cognate immunity protein RhsI2
Keywords keywords	T6SS, effector-immunity compex, HNH endonuclease, DNAse, S. marcescens DB10, ANTIMICROBIAL PROTEIN; ANTIMICROBIAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8cm0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8cm0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8cm0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.65 Å
Rg (electron density)	21.76 Å
Total Rg	22.54 Å
Atom count	2201
Residues	273
Excluded volume	39141 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8cm0__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Immunity protein RhsI2
Molecular weight formula_weight	18682.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	2332

MNEFDFDSLLQRIDSSCFFSRMGLPDVLDSRVILIENVEKVFVNPTDAEFKGYYDSVEWLPTSMTQEDPFYKVKEVLPKELTGLRIRVNKAVMNATKGLSKDKFNYGPHDFSLAARNGICFAFREYVSEQYLHLGNKWEEVVGIYFSGHWPVGIAKDKIVTI

Source Source

Source organism organism	Serratia marcescens
NCBI taxonomy ID ncbi_taxonomy_id	615
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Rhs-family protein
Molecular weight formula_weight	17797.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MGSSHHHHHHSSGENLYFQGGSNCSTLDRIIGDANKVASRGGAITAKQAQILRDNLPVVQRRSVFQNQMARKEFVRDQHYLMSQWEANTGRTWPTGATPHHIIPLESGGANKWWNLMPTHGTLPNHSLPGVPGPHAAGGVLRTTVQQSRKALPPGTITDLRL

Source Source

Source organism organism	Serratia marcescens
NCBI taxonomy ID ncbi_taxonomy_id	615
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	131

▶

Unit-cell length a length_a	37.006 Å
Unit-cell length b length_b	81.931 Å
Unit-cell length c length_c	101.371 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.170 Å
Low-resolution limit resolution_low	37.980 Å
R factor r_factor	—
R_work r_work	0.1950
R_free r_free	0.2526

Rhs2-CT endonuclease toxin in complex with cognate immunity protein RhsI2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunity protein RhsI2

State in the Current Structure

Other States of the Same Protein in the Database

Rhs-family protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8cm0__assembly_1__model_1

8cm0__assembly_1__model_1 | I(q)

8cm0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Rhs2-CT endonuclease toxin in complex with cognate immunity protein RhsI2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Immunity protein RhsI2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Rhs-family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8cm0__assembly_1__model_1

8cm0__assembly_1__model_1 | I(q)

8cm0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)