SAXSdb — 8e8x

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein VP1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	Capsid protein VP2 × 60 （P03302） Capsid protein VP3 × 60 （A0A2H4WRH7） Capsid protein VP4 × 60 （A0A2H4Z5W5） 9H2 Fab heavy chain × 60 9H2 Fab light chain × 60 PALMITIC ACID × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Capsid protein VP2 × 1 （P03302） Capsid protein VP3 × 1 （A0A2H4WRH7） Capsid protein VP4 × 1 （A0A2H4Z5W5） 9H2 Fab heavy chain × 1 9H2 Fab light chain × 1 PALMITIC ACID × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	Capsid protein VP2 × 5 （P03302） Capsid protein VP3 × 5 （A0A2H4WRH7） Capsid protein VP4 × 5 （A0A2H4Z5W5） 9H2 Fab heavy chain × 5 9H2 Fab light chain × 5 PALMITIC ACID × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	Capsid protein VP2 × 6 （P03302） Capsid protein VP3 × 6 （A0A2H4WRH7） Capsid protein VP4 × 6 （A0A2H4Z5W5） 9H2 Fab heavy chain × 6 9H2 Fab light chain × 6 PALMITIC ACID × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	Capsid protein VP2 × 1 （P03302） Capsid protein VP3 × 1 （A0A2H4WRH7） Capsid protein VP4 × 1 （A0A2H4Z5W5） 9H2 Fab heavy chain × 1 9H2 Fab light chain × 1 PALMITIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2X7G8_9ENTO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–279； UniProt 22–300

Capsid protein VP2

OrganismNot specified

UniProt P03302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	Capsid protein VP1 × 60 （B2X7G8） Capsid protein VP3 × 60 （A0A2H4WRH7） Capsid protein VP4 × 60 （A0A2H4Z5W5） 9H2 Fab heavy chain × 60 9H2 Fab light chain × 60 PALMITIC ACID × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Capsid protein VP1 × 1 （B2X7G8） Capsid protein VP3 × 1 （A0A2H4WRH7） Capsid protein VP4 × 1 （A0A2H4Z5W5） 9H2 Fab heavy chain × 1 9H2 Fab light chain × 1 PALMITIC ACID × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	Capsid protein VP1 × 5 （B2X7G8） Capsid protein VP3 × 5 （A0A2H4WRH7） Capsid protein VP4 × 5 （A0A2H4Z5W5） 9H2 Fab heavy chain × 5 9H2 Fab light chain × 5 PALMITIC ACID × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	Capsid protein VP1 × 6 （B2X7G8） Capsid protein VP3 × 6 （A0A2H4WRH7） Capsid protein VP4 × 6 （A0A2H4Z5W5） 9H2 Fab heavy chain × 6 9H2 Fab light chain × 6 PALMITIC ACID × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	Capsid protein VP1 × 1 （B2X7G8） Capsid protein VP3 × 1 （A0A2H4WRH7） Capsid protein VP4 × 1 （A0A2H4Z5W5） 9H2 Fab heavy chain × 1 9H2 Fab light chain × 1 PALMITIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLG_POL3L
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–263； UniProt 78–340

Capsid protein VP3

OrganismNot specified

UniProt A0A2H4WRH7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	Capsid protein VP1 × 60 （B2X7G8） Capsid protein VP2 × 60 （P03302） Capsid protein VP4 × 60 （A0A2H4Z5W5） 9H2 Fab heavy chain × 60 9H2 Fab light chain × 60 PALMITIC ACID × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Capsid protein VP1 × 1 （B2X7G8） Capsid protein VP2 × 1 （P03302） Capsid protein VP4 × 1 （A0A2H4Z5W5） 9H2 Fab heavy chain × 1 9H2 Fab light chain × 1 PALMITIC ACID × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	Capsid protein VP1 × 5 （B2X7G8） Capsid protein VP2 × 5 （P03302） Capsid protein VP4 × 5 （A0A2H4Z5W5） 9H2 Fab heavy chain × 5 9H2 Fab light chain × 5 PALMITIC ACID × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	Capsid protein VP1 × 6 （B2X7G8） Capsid protein VP2 × 6 （P03302） Capsid protein VP4 × 6 （A0A2H4Z5W5） 9H2 Fab heavy chain × 6 9H2 Fab light chain × 6 PALMITIC ACID × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	Capsid protein VP1 × 1 （B2X7G8） Capsid protein VP2 × 1 （P03302） Capsid protein VP4 × 1 （A0A2H4Z5W5） 9H2 Fab heavy chain × 1 9H2 Fab light chain × 1 PALMITIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2H4WRH7_9ENTO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–235； UniProt 341–575

Capsid protein VP4

OrganismNot specified

UniProt A0A2H4Z5W5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	Capsid protein VP1 × 60 （B2X7G8） Capsid protein VP2 × 60 （P03302） Capsid protein VP3 × 60 （A0A2H4WRH7） 9H2 Fab heavy chain × 60 9H2 Fab light chain × 60 PALMITIC ACID × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Capsid protein VP1 × 1 （B2X7G8） Capsid protein VP2 × 1 （P03302） Capsid protein VP3 × 1 （A0A2H4WRH7） 9H2 Fab heavy chain × 1 9H2 Fab light chain × 1 PALMITIC ACID × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	Capsid protein VP1 × 5 （B2X7G8） Capsid protein VP2 × 5 （P03302） Capsid protein VP3 × 5 （A0A2H4WRH7） 9H2 Fab heavy chain × 5 9H2 Fab light chain × 5 PALMITIC ACID × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	Capsid protein VP1 × 6 （B2X7G8） Capsid protein VP2 × 6 （P03302） Capsid protein VP3 × 6 （A0A2H4WRH7） 9H2 Fab heavy chain × 6 9H2 Fab light chain × 6 PALMITIC ACID × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	Capsid protein VP1 × 1 （B2X7G8） Capsid protein VP2 × 1 （P03302） Capsid protein VP3 × 1 （A0A2H4WRH7） 9H2 Fab heavy chain × 1 9H2 Fab light chain × 1 PALMITIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2H4Z5W5_9ENTO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 4； PDBConstruct 1–68； UniProt 2–69

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8e8x
Deposition date deposition_date	2022-08-26
Structure title title	9H2 Fab-Sabin poliovirus 3 complex
Keywords keywords	Complex, Fab, poliovirus, neutralizing, VIRUS-IMMUNE SYSTEM complex; VIRUS/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8e8x__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8e8x__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8e8x__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	140.20 Å
Total Rg	140.30 Å
Atom count	499740
Residues	63960
Excluded volume	8866400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8e8x__assembly_1__model_1`	360-meric （360）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8e8x__assembly_2__model_1`	hexameric （6）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`8e8x__assembly_3__model_1`	30-meric （30）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`8e8x__assembly_4__model_1`	36-meric （36）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`8e8x__assembly_5__model_1`	hexameric （6）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Capsid protein VP1
Molecular weight formula_weight	31358.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	8329

QDSLPDTKASGPAHSKEVPALTAVETGATNPLAPSDTVQTRHVVQRRSRSESTIESFFARGACVAIIEVDNEQPTTRAQKLFAMWRITYKDTVQLRRKLEFFTYSRFDMEFTFVVTANFTNANNGHALNQVYQIMYIPPGAPTPKSWDDYTWQTSSNPSIFYTYGAAPARISVPYVGLANAYSHFYDGFAKVPLKTDANDQIGDSLYSAMTVDDFGVLAVRVVNDHNPTKVTSKVRIYMKPKHVRVWCPRPPRAVPYYGPGVDYRNNLDPLSEKGLTTY

Entity 2 Entity 2 polymer

Description description	Capsid protein VP2
Molecular weight formula_weight	29412.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

YSDRVLQLTLGNSTITTQEAANSVVAYGRWPEFIRDDEANPVDQPTEPDVATCRFYTLDTVMWGKESKGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYCLAGDSDKQRYTSYANANPGERGGKFYSQFNKDNAVTSPKREFCPVDYLLGCGVLLGNAFVYPHQIINLRTNNSATIVLPYVNALAIDSMVKHNNWGIAILPLSPLDFAQDSSVEIPITVTIAPMCSEFNGLRNVTAPKFQ

Entity 3 Entity 3 polymer

Description description	Capsid protein VP3
Molecular weight formula_weight	25950.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GLPVLNTPGSNQYLTSDNHQSPCAIPEFDVTPPIDIPGEVKNMMELAEIDTMIPLNLESTKRNTMDMYRVTLSDSADLSQPILCLSLSPAFDPRLSHTMLGEVLNYYTHWAGSLKFTFLFCGSMMATGKILVAYAPPGAQPPTSRKEAMLGTHVIWDLGLQSSCTMVVPWISNVTYRQTTQDSFTEGGYISMFYQTRIVVPLSTPKSMSMLGFVSACNDFSVRLLRDTTHISQSA

Entity 4 Entity 4 polymer

Description description	Capsid protein VP4
Molecular weight formula_weight	7320.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAQVSSQKVGAHENSNRAYGGSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN

Entity 5 Entity 5 polymer

Description description	9H2 Fab heavy chain
Molecular weight formula_weight	14052.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

LVQSGAELKKPGASVKFSCQASGFTFTTYDIHWVRQAPGQGLEWMGMISPSRDSTIYAQKFQGRVTMTSDTSTSTVYMELTSLRSEDTALYYCATASRPSAWVFRSLYTYYYMDVWGTGTTVTVSS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	9H2 Fab light chain
Molecular weight formula_weight	11738.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

QSALTQPASVSGSPGQSITISCTGTITDIGYYNYVSWYQQHPGKAPKLIIFDVTNRPSGVSDRFSGSKSGNTASLTISGLQAEDEGDYYCFSHRSNNIRVFGGGTKLTVL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	8e8x101
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	8e8x201
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	8e8xH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	8e8xL01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.91 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	52115

9H2 Fab-Sabin poliovirus 3 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein VP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid protein VP2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid protein VP3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid protein VP4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8e8x__assembly_1__model_1

8e8x__assembly_1__model_1 | I(q)

8e8x__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)