8esc

Structure of the Yeast NuA4 Histone Acetyltransferase Complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription-associated protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Actin-related protein 4 × 1 （P80428） Actin × 1 （P60010） Enhancer of polycomb-like protein 1 × 1 （P43572） Chromatin modification-related protein EAF1 × 1 （Q06337） SWR1-complex protein 4 × 1 （P53201） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRA1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Z； PDBConstruct 1–3744； UniProt 1–3744

Actin-related protein 4

OrganismNot specified

UniProt P80428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Transcription-associated protein 1 × 1 （P38811） Actin × 1 （P60010） Enhancer of polycomb-like protein 1 × 1 （P43572） Chromatin modification-related protein EAF1 × 1 （Q06337） SWR1-complex protein 4 × 1 （P53201） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP4_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain R； PDBConstruct 1–489； UniProt 1–489

Actin

OrganismNot specified

UniProt P60010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Transcription-associated protein 1 × 1 （P38811） Actin-related protein 4 × 1 （P80428） Enhancer of polycomb-like protein 1 × 1 （P43572） Chromatin modification-related protein EAF1 × 1 （Q06337） SWR1-complex protein 4 × 1 （P53201） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACT_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–375； UniProt 1–375

Enhancer of polycomb-like protein 1

OrganismNot specified

UniProt P43572

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Transcription-associated protein 1 × 1 （P38811） Actin-related protein 4 × 1 （P80428） Actin × 1 （P60010） Chromatin modification-related protein EAF1 × 1 （Q06337） SWR1-complex protein 4 × 1 （P53201） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EPL1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain P； PDBConstruct 1–832； UniProt 1–832

Chromatin modification-related protein EAF1

OrganismNot specified

UniProt Q06337

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Transcription-associated protein 1 × 1 （P38811） Actin-related protein 4 × 1 （P80428） Actin × 1 （P60010） Enhancer of polycomb-like protein 1 × 1 （P43572） SWR1-complex protein 4 × 1 （P53201） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EAF1_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–982； UniProt 1–982

SWR1-complex protein 4

OrganismNot specified

UniProt P53201

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Transcription-associated protein 1 × 1 （P38811） Actin-related protein 4 × 1 （P80428） Actin × 1 （P60010） Enhancer of polycomb-like protein 1 × 1 （P43572） Chromatin modification-related protein EAF1 × 1 （Q06337） ADENOSINE-5'-TRIPHOSPHATE × 1 MAGNESIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SWC4_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain S； PDBConstruct 1–476； UniProt 1–476

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8esc
Deposition date deposition_date	2022-10-13
Structure title title	Structure of the Yeast NuA4 Histone Acetyltransferase Complex
Keywords keywords	Histone Acetyltransferase, NuA4, Yeast, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8esc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8esc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8esc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	70.41 Å
Rg (electron density)	70.59 Å
Total Rg	70.54 Å
Atom count	43279
Residues	5300
Excluded volume	777050 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8esc__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Transcription-associated protein 1
Molecular weight formula_weight	433677.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z
Atom count atom_count	43279

MSLTEQIEQFASRFRDDDATLQSRYSTLSELYDIMELLNSPEDYHFFLQAVIPLLLNQLKEVPISYDAHSPEQKLRNSMLDIFNRCLMNQTFQPYAMEVLEFLLSVLPKENEENGILCMKVLTTLFKSFKSILQDKLDSFIRIIIQIYKNTPNLINQTFYEAGKAEQGDLDSPKEPQADELLDEFSKNDEEKDFPSKQSSTEPRFENSTSSNGLRSSMFSFKILSECPITMVTLYSSYKQLTSTSLPEFTPLIMNLLNIQIKQQQEAREQAESRGEHFTSISTEIINRPAYCDFILAQIKATSFLAYVFIRGYAPEFLQDYVNFVPDLIIRLLQDCPSELSSARKELLHATRHILSTNYKKLFLPKLDYLFDERILIGNGFTMHETLRPLAYSTVADFIHNIRSELQLSEIEKTIKIYTGYLLDESLALTVQIMSAKLLLNLVERILKLGKENPQEAPRAKKLLMIIIDSYMNRFKTLNRQYDTIMKYYGRYETHKKEKAEKLKNSIQDNDKESEEFMRKVLEPSDDDHLMPQPKKEDINDSPDVEMTESDKVVKNDVEMFDIKNYAPILLLPTPTNDPIKDAFYLYRTLMSFLKTIIHDLKVFNPPPNEYTVANPKLWASVSRVFSYEEVIVFKDLFHECIIGLKFFKDHNEKLSPETTKKHFDISMPSLPVSATKDARELMDYLAFMFMQMDNATFNEIIEQELPFVYERMLEDSGLLHVAQSFLTSEITSPNFAGILLRFLKGKLKDLGNVDFNTSNVLIRLFKLSFMSVNLFPNINEVVLLPHLNDLILNSLKYSTTAEEPLVYFYLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNQMILTARLPHERELYVELCITVPVRLSVLAPYLPFLMKPLVFALQQYPDLVSQGLRTLELCIDNLTAEYFDPIIEPVIDDVSKALFNLLQPQPFNHAISHNVVRILGKLGGRNRQFLKPPTDLTEKTELDIDAIADFKINGMPEDVPLSVTPGIQSALNILQSYKSDIHYRKSAYKYLTCVLLLMTKSSAEFPTNYTELLKTAVNSIKLERIGIEKNFDLEPTVNKRDYSNQENLFLRLLESVFYATSIKELKDDAMDLLNNLLDHFCLLQVNTTLLNKRNYNGTFNIDLKNPNFMLDSSLILDAIPFALSYYIPEVREVGVLAYKRIYEKSCLIYGEELALSHSFIPELAKQFIHLCYDETYYNKRGGVLGIKVLIDNVKSSSVFLKKYQYNLANGLLFVLKDTQSEAPSAITDSAEKLLIDLLSITFADVKEEDLGNKVLENTLTDIVCELSNANPKVRNACQKSLHTISNLTGIPIVKLMDHSKQFLLSPIFAKPLRALPFTMQIGNVDAITFCLSLPNTFLTFNEELFRLLQESIVLADAEDESLSTNIQKTTEYSTSEQLVQLRIACIKLLAIALKNEEFATAQQGNIRIRILAVFFKTMLKTSPEIINTTYEALKGSLAENSKLPKELLQNGLKPLLMNLSDHQKLTVPGLDALSKLLELLIAYFKVEIGRKLLDHLTAWCRVEVLDTLFGQDLAEQMPTKIIVSIINIFHLLPPQADMFLNDLLLKVMLLERKLRLQLDSPFRTPLARYLNRFHNPVTEYFKKNMTLRQLVLFMCNIVQRPEAKELAEDFEKELDNFYDFYISNIPKNQVRVVSFFTNMVDLFNTMVITNGDEWLKKKGNMILKLKDMLNLTLKTIKENSFYIDHLQLNQSIAKFQALYLRFTELSERDQNPLLLDFIDFSFSNGIKASYSLKKFIFHNIIASSNKEKQNNFINDATLFVLSDKCLDARIFVLKNVINSTLIYEVATSGSLKSYLVEDKKPKWLELLHNKIWKNSNAILAYDVLDHHDLFRFELLQLSAIFIKADPEIIAEIKKDIIKFCWNFIKLEDTLIKQSAYLVTSYFISKFDFPIKVVTQVFVALLRSSHVEARYLVKQSLDVLTPVLHERMNAAGTPDTWINWVKRVMVENSSSQNNILYQFLISHPDLFFNSRDLFISNIIHHMNKITFMSNSNSDSHTLAIDLASLILYWENKTLEITNVNNTKTDSDGDVVMSDSKSDINPVEADTTAIIVDANNNSPISLHLREACTAFLIRYVCASNHRAIETELGLRAINILSELISDKHWTNVNVKLVYFEKFLIFQDLDSENILYYCMNALDVLYVFFKNKTKEWIMENLPTIQNLLEKCIKSDHHDVQEALQKVLQVIMKAIKAQGVSVIIEEESPGKTFIQMLTSVITQDLQETSSVTAGVTLAWVLFMNFPDNIVPLLTPLMKTFSKLCKDHLSISQPKDAMALEEARITTKLLEKVLYILSLKVSLLGDSRRPFLSTVALLIDHSMDQNFLRKIVNMSRSWIFNTEIFPTVKEKAAILTKMLAFEIRGEPSLSKLFYEIVLKLFDQEHFNNTEITVRMEQPFLVGTRVEDIGIRKRFMTILDNSLERDIKERLYYVIRDQNWEFIADYPWLNQALQLLYGSFNREKELSLKNIYCLSPPSILQEYLPENAEMVTEVNDLELSNFVKGHIASMQGLCRIISSDFIDSLIEIFYQDPKAIHRAWVTLFPQVYKSIPKNEKYGFVRSIITLLSKPYHTRQISSRTNVINMLLDSISKIESLELPPHLVKYLAISYNAWYQSINILESIQSNTSIDNTKIIEANEDALLELYVNLQEEDMFYGLWRRRAKYTETNIGLSYEQIGLWDKAQQLYEVAQVKARSGALPYSQSEYALWEDNWIQCAEKLQHWDVLTELAKHEGFTDLLLECGWRVADWNSDRDALEQSVKSVMDVPTPRRQMFKTFLALQNFAESRKGDQEVRKLCDEGIQLSLIKWVSLPIRYTPAHKWLLHGFQQYMEFLEATQIYANLHTTTVQNLDSKAQEIKRILQAWRDRLPNTWDDVNMWNDLVTWRQHAFQVINNAYLPLIPALQQSNSNSNINTHAYRGYHEIAWVINRFAHVARKHNMPDVCISQLARIYTLPNIEIQEAFLKLREQAKCHYQNMNELTTGLDVISNTNLVYFGTVQKAEFFTLKGMFLSKLRAYEEANQAFATAVQIDLNLAKAWAQWGFFNDRRLSEEPNNISFASNAISCYLQAAGLYKNSKIRELLCRILWLISIDDASGMLTNAFDSFRGEIPVWYWITFIPQLLTSLSHKEANMVRHILIRIAKSYPQALHFQLRTTKEDFAVIQRQTMAVMGDKPDTNDRNGRRQPWEYLQELNNILKTAYPLLALSLESLVAQINDRFKSTTDEDLFRLINVLLIDGTLNYNRLPFPRKNPKLPENTEKNLVKFSTTLLAPYIRPKFNADFIDNKPDYETYIKRLRYWRRRLENKLDRASKKENLEVLCPHLSNFHHQKFEDIEIPGQYLLNKDNNVHFIKIARFLPTVDFVRGTHSSYRRLMIRGHDGSVHSFAVQYPAVRHSRREERMFQLYRLFNKSLSKNVETRRRSIQFNLPIAIPLSPQVRIMNDSVSFTTLHEIHNEFCKKKGFDPDDIQDFMADKLNAAHDDALPAPDMTILKVEIFNSIQTMFVPSNVLKDHFTSLFTQFEDFWLFRKQFASQYSSFVFMSYMMMINNRTPHKIHVDKTSGNVFTLEMLPSRFPYERVKPLLKNHDLSLPPDSPIFHNNEPVPFRLTPNIQSLIGDSALEGIFAVNLFTISRALIEPDNELNTYLALFIRDEIISWFSNLHRPIIENPQLREMVQTNVDLIIRKVAQLGHLNSTPTVTTQFILDCIGSAVSPRNLARTDVNFMPWF

Entity 2 Entity 2 polymer

Description description	Actin-related protein 4
Molecular weight formula_weight	54894.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MSNAALQVYGGDEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKYTADEGNKKIFSEQSIGIPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLPKEDDIPANWPRSNSGVVKTWRNDYVPLKRTKPSGVNKSDKKVTPTEEKEQEAVSKSTSPAANSADTPNETGKRPLEEEKPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRFR

Entity 3 Entity 3 polymer

Description description	Actin
Molecular weight formula_weight	41735.5 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF

Entity 4 Entity 4 polymer

Description description	Enhancer of polycomb-like protein 1
Molecular weight formula_weight	96889.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MPTPSNAIEINDGSHKSGRSTRRSGSRSAHDDGLDSFSKGDSGAGASAGSSNSRFRHRKISVKQHLKIYLPNDLKHLDKDELQQREVVEIETGVEKNEEKEVHLHRILQMGSGHTKHKDYIPTPDASMTWNEYDKFYTGSFQETTSYIKFSATVEDCCGTNYNMDERDETFLNEQVNKGSSDILTEDEFEILCSSFEHAIHERQPFLSMDPESILSFEELKPTLIKSDMADFNLRNQLNHEINSHKTHFITQFDPVSQMNTRPLIQLIEKFGSKIYDYWRERKIEVNGYEIFPQLKFERPGEKEEIDPYVCFRRREVRHPRKTRRIDILNSQRLRALHQELKNAKDLALLVAKRENVSLNWINDELKIFDQRVKIKNLKRSLNISGEDDDLINHKRKRPTIVTVEQREAELRKAELKRAAAAAAAAKAKNNKRNNQLEDKSSRLTKQQQQQLLQQQQQQQQNALKTENGKQLANASSSSTSQPITSHVYVKLPSSKIPDIVLEDVDALLNSKEKNARKFVQEKMEKRKIEDADVFFNLTDDPFNPVFDMSLPKNFSTSNVPFASIASSKFQIDRSFYSSHLPEYLKGISDDIRIYDSNGRSRNKDNYNLDTKRIKKTELYDPFQENLEIHSREYPIKFRKRVGRSNIKYVDRMPNFTTSSTKSACSLMDFVDFDSIEKEQYSREGSNDTDSINVYDSKYDEFVRLYDKWKYDSPQNEYGIKFSDEPARLNQISNDTQVIRFGTMLGTKSYEQLREATIKYRRDYITRLKQKHIQHLQQQQQQQQQQQQQAQQQKQKSQNNNSNSSNSLKKLNDSLINSEAKQNSSITQKNSS

Entity 5 Entity 5 polymer

Description description	Chromatin modification-related protein EAF1
Molecular weight formula_weight	112667.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSSRPSSAVPNSASLSEDQSSDRSKFPKADDLIDERDRKLTELYCVSRLNQLLELTDENKLRKEIDAFLKKNDIRRGIRFDEASLPKLLHTAATPITKKKLKDVNLINVPNQRLSDSKMSRELPENSENVSVKSESHFVPSHDNSIRENMMDSLRPAEKTGGMWNKRPLESTMGGEEERHEKRQKMQSQSLESSNNSEMASLPISPRPPVPNALAHYTYYENIEYPPADPTEVQPAVKFKDPLIKNIMAKEIDTSDHYNENNVDALETVFLLMNDYIPSKIPQALPLAELKYMSQTLPLINLIPRAHKALTTNIINNALNEARITVVGSRIEELRRLGLWSLRQPKRFIDPWKQHNTHQNILLEEAKWMQADFKEGHKYKVAICTAMAQAIKDYWTYGEICCVKRKTLLPGKENKLSDDGRISEKSGRPSDTSRNDSDISIAGKDDIGIIANVDDITEKESAAANDNDENGKNEAGAKSDFDFADGLLSQEGAHDQIISSIDTKLLLKKPSSSSEVVLIQHEVAASSALIETEESKKELAPPFKLSIFVDELNTFEKTLIQDLPLYNGINEERPKKDDSLPFIPISKSVVSLDDNGFYKLLERQLIDEEPSISQLSKRRGMFYGNRRNHYLRPPAVPSLRYLQNRTPTIWLSEDDQELVKNINTYGYNWELISAHMTHRLTYSYLSNIERRTPWQCFERFVQLNERFNFSDLKGPRAHSAQQWLIEAHKFQQRQNRRISPLGVNTESIQRGHRRLRWASMFEAIRKCMKKRENTPRPNPTQPRKPLDCKNMKVPTPAEMSLLKAQRDEALRRDIQLRRTVKNRLQQRQQQSQQAHSSRAQSPIPSNGKSSSNLARNGQASAPRPNQKQYTEQDIIESYSRKLLEQKPDIGPEMALKAAKNYYRTLREQQQQLKQHQIQQQRQQLQEESSHVQQLQQLQPGSQAPPPKSSPSQSSLSNISNINSAPRIKSPTPQEILQRFQKQ

Entity 6 Entity 6 polymer

Description description	SWR1-complex protein 4
Molecular weight formula_weight	55297.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MSSSDIFDVLNIKQKSRSPTNGQVSVPSSSAANRPKPQVTGMQRELFNLLGENQPPVVIKSGNNFKEKMLSTSKPSPWSFVEFKANNSVTLRHWVKGSKELIGDTPKESPYSKFNQHLSIPSFTKEEYEAFMNENEGTQKSVESEKNHNENFTNEKKDESKNSWSFEEIEYLFNLCKKYDLRWFLIFDRYSYNNSRTLEDLKEKFYYTCRNYFKASDPSNPLLSSLNFSAEKEIERKKYLQRLLSRSAAEIAEEEALVVESKKFEMAAKRTLAERESLLRLLDSPHSDQTITQYLTSQGMSQLYNALLADKTRKRKHDLNIPENPWMKQQQQFAQHRQLQQLNVKKSEVKENLSPKKTKRQRQEMQTALKRKSESAYAEQLLKDFNSDERKALGVITHGEKLSPGVYLRSTKLSTFKPALQNKILAILQELSLPSRPVMPSFDVMERQEELLKKINTLIDLKKHVDKYEAGMSITK

Entity 7 Entity 7 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	8escA01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	640 — Actin; Chain A, domain 4
Homologous superfamily homologous superfamily	10 — ATPase, substrate binding domain, subdomain 4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	635860

Structure of the Yeast NuA4 Histone Acetyltransferase Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription-associated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Enhancer of polycomb-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin modification-related protein EAF1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWR1-complex protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8esc__assembly_1__model_1

8esc__assembly_1__model_1 | I(q)

8esc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)