SAXSdb — 8fwa

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-phycocyanin alpha chain

Thermosynechococcus vestitus BP-1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	C-phycocyanin beta chain × 6 （P50033） PHYCOCYANOBILIN × 18 SODIUM ION × 6 water × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	C-phycocyanin beta chain × 1 （P50033） PHYCOCYANOBILIN × 3 SODIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCA_THEEB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–162； UniProt 1–162

C-phycocyanin beta chain

Thermosynechococcus vestitus BP-1

UniProt P50033

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	C-phycocyanin alpha chain × 6 （P50032） PHYCOCYANOBILIN × 18 SODIUM ION × 6 water × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	C-phycocyanin alpha chain × 1 （P50032） PHYCOCYANOBILIN × 3 SODIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCB_THEEB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–172； UniProt 1–172

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8fwa
Deposition date deposition_date	2023-01-20
Structure title title	Phycocyanin structure from a modular droplet injector for serial femtosecond crystallography
Keywords keywords	Pigment Protein, Serial femtosecond crystallography, segmented flow injector, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8fwa__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8fwa__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8fwa__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.71 Å
Rg (electron density)	25.31 Å
Total Rg	25.79 Å
Atom count	2629
Residues	333
Excluded volume	46826 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8fwa__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8fwa__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	C-phycocyanin alpha chain
Molecular weight formula_weight	17456.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2764

MKTPITEAIAAADTQGRFLSNTELQAVDGRFKRAVASMEAARALTNNAQSLIDGAAQAVYQKFPYTTTMQGSQYASTPEGKAKCARDIGYYLRMVTYCLVAGGTGPMDEYLIAGLSEINSTFDLSPSWYIEALKYIKANHGLTGQAAVEANAYIDYAINALS

Source Source

Source organism organism	Thermosynechococcus vestitus BP-1
NCBI taxonomy ID ncbi_taxonomy_id	197221
Host organism host_organism	Thermosynechococcus vestitus

Entity 2 Entity 2 polymer

Description description	C-phycocyanin beta chain
Molecular weight formula_weight	18216.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MLDAFAKVVAQADARGEFLTNAQFDALSNLVKEGNKRLDAVNRITSNASTIVANAARALFAEQPQLIQPGGNAYTNRRMAACLRDMEIILRYVTYAILAGDSSVLDDRCLNGLRETYQALGTPGSSVAVAIQKMKDAAIAIANDPNGITPGDCSALMSEIAGYFDRAAAAVA

Source Source

Source organism organism	Thermosynechococcus vestitus BP-1
NCBI taxonomy ID ncbi_taxonomy_id	197221
Host organism host_organism	Thermosynechococcus vestitus

Entity 3 Entity 3 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	126

▶

Unit-cell length a length_a	188.300 Å
Unit-cell length b length_b	188.300 Å
Unit-cell length c length_c	61.100 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3 2
Space-group number int_tables_number	155
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	22.310 Å
R factor r_factor	0.2063
R_work r_work	0.2043
R_free r_free	0.2451

Phycocyanin structure from a modular droplet injector for serial femtosecond crystallography

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-phycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

C-phycocyanin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8fwa__assembly_2__model_1

8fwa__assembly_2__model_1 | I(q)

8fwa__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Phycocyanin structure from a modular droplet injector for serial femtosecond crystallography

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-phycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-phycocyanin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8fwa__assembly_2__model_1

8fwa__assembly_2__model_1 | I(q)

8fwa__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)