SAXSdb — 8guf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Heat-labile enterotoxin IIB, B chain

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 5	No other associated polymer	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E2BB_ECOLX
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 3–101； UniProt 24–122 Author chain E； PDBConstruct 3–101； UniProt 24–122 Author chain B； PDBConstruct 1–99； UniProt 24–122 Author chain C； PDBConstruct 1–99； UniProt 24–122 Author chain D； PDBConstruct 1–99； UniProt 24–122

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8guf
Deposition date deposition_date	2022-09-12
Structure title title	Crystal structure of cyclic B subunit of type II heat labile enterotoxin
Keywords keywords	mucosal adjuvant, B subunit of type II heat labile enterotoxin, RECOMBINATION; RECOMBINATION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8guf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8guf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8guf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.06 Å
Rg (electron density)	22.76 Å
Total Rg	23.41 Å
Atom count	3830
Residues	513
Excluded volume	67592 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8guf__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Heat-labile enterotoxin IIB, B chain
Molecular weight formula_weight	11066.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	3830

GSGASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEAEGS

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Heat-labile enterotoxin IIB, B chain
Molecular weight formula_weight	11066.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C,D

GASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEAEGSGS

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	132.129 Å
Unit-cell length b length_b	70.178 Å
Unit-cell length c length_c	60.772 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	117.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.990 Å
Low-resolution limit resolution_low	29.420 Å
R factor r_factor	0.2164
R_work r_work	0.2141
R_free r_free	0.2597

Crystal structure of cyclic B subunit of type II heat labile enterotoxin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Heat-labile enterotoxin IIB, B chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8guf__assembly_1__model_1

8guf__assembly_1__model_1 | I(q)

8guf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Crystal structure of cyclic B subunit of type II heat labile enterotoxin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Heat-labile enterotoxin IIB, B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8guf__assembly_1__model_1

8guf__assembly_1__model_1 | I(q)

8guf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)