8ibb

Respiratory complex Membrane domain of CI, focus-refined of type IB, Wild type mouse under cold temperature

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS2_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain D； PDBConstruct 1–463； UniProt 1–463

NADH-ubiquinone oxidoreductase chain 6

OrganismNot specified

UniProt P03925

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6M_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 1–172； UniProt 1–172

NADH-ubiquinone oxidoreductase chain 4L

OrganismNot specified

UniProt P03903

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LM_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain K； PDBConstruct 1–98； UniProt 1–98

NADH-ubiquinone oxidoreductase chain 5

OrganismNot specified

UniProt P03921

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5M_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain L； PDBConstruct 1–607； UniProt 1–607

NADH-ubiquinone oxidoreductase chain 4

OrganismNot specified

UniProt P03911

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4M_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain M； PDBConstruct 1–459； UniProt 1–459

NADH-ubiquinone oxidoreductase chain 2

OrganismNot specified

UniProt P03893

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2M_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain N； PDBConstruct 1–345； UniProt 1–345

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

OrganismNot specified

UniProt Q99LC3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAA_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain O； PDBConstruct 1–355； UniProt 1–355

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt Q9CR21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain U； PDBConstruct 1–156； UniProt 1–156

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

OrganismNot specified

UniProt Q9DCJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA8_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain X； PDBConstruct 1–172； UniProt 1–172

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11

OrganismNot specified

UniProt G5E814

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G5E814_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Y； PDBConstruct 1–143； UniProt 1–143

NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

OrganismNot specified

UniProt Q9CQY9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUC1_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain c； PDBConstruct 1–76； UniProt 1–76

NADH dehydrogenase [ubiquinone] 1 subunit C2

OrganismNot specified

UniProt Q9CQ54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUC2_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain d； PDBConstruct 1–120； UniProt 1–120

NADH dehydrogenase [ubiquinone] iron-sulfur protein 5

OrganismNot specified

UniProt Q99LY9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS5_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain e； PDBConstruct 1–106； UniProt 1–106

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

OrganismNot specified

UniProt P0DN34

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB1_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain f； PDBConstruct 1–57； UniProt 1–57

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial

OrganismNot specified

UniProt O09111

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUBB_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain g； PDBConstruct 1–151； UniProt 1–151

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial

OrganismNot specified

UniProt Q9CQH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB5_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain h； PDBConstruct 1–189； UniProt 1–189

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

OrganismNot specified

UniProt Q3UIU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB6_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain i； PDBConstruct 1–128； UniProt 1–128

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

OrganismNot specified

UniProt Q9CPU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB2_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain j； PDBConstruct 1–105； UniProt 1–105

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3

OrganismNot specified

UniProt Q9CQZ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB3_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain k； PDBConstruct 1–104； UniProt 1–104

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

OrganismNot specified

UniProt Q9D6J5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB8_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain l； PDBConstruct 1–186； UniProt 1–186

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4

OrganismNot specified

UniProt Q9CQC7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB4_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain m； PDBConstruct 1–129； UniProt 1–129

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9

OrganismNot specified

UniProt Q9CQJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB9_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain n； PDBConstruct 1–179； UniProt 1–179

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

OrganismNot specified

UniProt Q9CR61

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB7_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain o； PDBConstruct 1–137； UniProt 1–137

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10

OrganismNot specified

UniProt Q9DCS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CARDIOLIPIN × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADENOSINE-5'-DIPHOSPHATE × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUBA_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain p； PDBConstruct 1–176； UniProt 1–176

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ibb
Deposition date deposition_date	2023-02-10
Structure title title	Respiratory complex Membrane domain of CI, focus-refined of type IB, Wild type mouse under cold temperature
Keywords keywords	Respiratory complex, Respiratory supercomplex, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ibb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ibb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ibb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.53 Å
Rg (electron density)	51.83 Å
Total Rg	51.86 Å
Atom count	31880
Residues	3815
Excluded volume	580540 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ibb__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
Molecular weight formula_weight	52693.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D
Atom count atom_count	31880

MAALRALRCLRGVGAPVLRPGSGIRLPSQPSRGARQWQPDIEWAEQFSGAVMYPSKETAHWKPPPWNDVDILKEKAVTNMTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSIAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLLDDIYEFSKNFSLRIDEVEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSLRIIEQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEIDR

Entity 2 Entity 2 polymer

Description description	NADH-ubiquinone oxidoreductase chain 6
Molecular weight formula_weight	18628.1 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MNNYIFVLSSLFLVGCLGLALKPSPIYGGLGLIVSGFVGCLMVLGFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEEYPETWGSNWLILGFLVLGVIMEVFLICVLNYYDEVGVINLDGLGDWLMYEVDDVGVMLEGGIGVAAMYSCATWMMVVAGWSLFAGIFIIIEITRD

Entity 3 Entity 3 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4L
Molecular weight formula_weight	10609.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MPSTFFNLTMAFSLSLLGTLMFRSHLMSTLLCLEGMVLSLFIMTSVTSLNSNSMSSMPIPITILVFAACEAAVGLALLVKVSNTYGTDYVQNLNLLQC

Entity 4 Entity 4 polymer

Description description	NADH-ubiquinone oxidoreductase chain 5
Molecular weight formula_weight	68519.3 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MNIFTTSILLIFILLLSPILISMSNLIKHINFPLYTTTSIKFSFIISLLPLLMFFHNNMEYMITTWHWVTMNSMELKMSFKTDFFSILFTSVALFVTWSIMQFSSWYMHSDPNINRFIKYLTLFLITMLILTSANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMVWFSLNMNSWELQQIMFSNNNDNLIPLMGLLIAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLVRFHPLTTNNNFILTTMLCLGALTTLFTAICALTQNDIKKIIAFSTSSQLGLMMVTLGMNQPHLAFLHICTHAFFKAMLFMCSGSIIHSLADEQDIRKMGNITKIMPFTSSCLVIGSLALTGMPFLTGFYSKDLIIEAINTCNTNAWALLITLIATSMTAMYSMRIIYFVTMTKPRFPPLISINENDPDLMNPIKRLAFGSIFAGFVISYNIPPTSIPVLTMPWFLKTTALIISVLGFLIALELNNLTMKLSMNKANPYSSFSTLLGFFPSIIHRITPMKSLNLSLKTSLTLLDLIWLEKTIPKSTSTLHTNMTTLTTNQKGLIKLYFMSFLINIILIIILYSINLE

Entity 5 Entity 5 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4
Molecular weight formula_weight	51915.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MLKIILPSLMLLPLTWLSSPKKTWTNVTSYSFLISLTSLTLLWQTDENYKNFSNMFSSDPLSTPLIILTAWLLPLMLMASQNHLKKDNNVLQKLYISMLISLQILLIMTFSATELIMFYILFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLIGSIPLLIALILIQNHVGTLNLMILSFTTHTLDASWSNNLLWLACMMAFLIKMPLYGVHLWLPKAHVEAPIAGSMILAAILLKLGSYGMIRISIILDPLTKYMAYPFILLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIASIMIQTPWSFMGATMLMIAHGLTSSLLFCLANSNYERIHSRTMIMARGLQMVFPLMATWWLMASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLTNHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM

Entity 6 Entity 6 polymer

Description description	NADH-ubiquinone oxidoreductase chain 2
Molecular weight formula_weight	38772.2 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MNPITLAIIYFTIFLGPVITMSSTNLMLMWVGLEFSLLAIIPMLINKKNPRSTEAATKYFVTQATASMIILLAIVLNYKQLGTWMFQQQTNGLILNMTLMALSMKLGLAPFHFWLPEVTQGIPLHMGLILLTWQKIAPLSILIQIYPLLNSTIILMLAITSIFMGAWGGLNQTQMRKIMAYSSIAHMGWMLAILPYNPSLTLLNLMIYIILTAPMFMALMLNNSMTINSISLLWNKTPAMLTMISLMLLSLGGLPPLTGFLPKWIIITELMKNNCLIMATLMAMMALLNLFFYTRLIYSTSLTMFPTNNNSKMMTHQTKTKPNLMFSTLAIMSTMTLPLAPQLIT

Entity 7 Entity 7 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
Molecular weight formula_weight	40657.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MALRLLRLVPASAPARGLAAGAQRVGRIHTSVHCKLRYGLLAAILGDKTTKKLHEYSRVITVDGNICSGKNKLAKEIAQQLGMKHYPEAGIQYSSTTTGDGRPLDIEFSGSCSLEKFYDDPKSNDGNSYRLQSWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYNQGYIRKQCVDHYNEIKRLTLPEYLPPHAVIYIDVPVPEVQSRIQKKGDPHEMKVTSAYLQDIENAYKKTFLPKMSEMCEVLVYDSWEAEDPTKVVEDIEYLKYNKGPWLKQDDWTFHYLRMLVQDKTEVLNYTTIPVYLPEITIGAHQGSRIYNSFRELPGRKYAPGYNAEVGDKWIWLK

Entity 8 Entity 8 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	17390.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 9 Entity 9 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Molecular weight formula_weight	20025.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MPGIVELPTLEELKVEEVKVSSAVLKAAAHHYGAQCDKTNKEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLDYSNMQLFRHCRQQQAKFDQCVLDKLGWVRPDLGQLSKVTKVKTDRPLPENPYHSRARPEPNPVIEGDLKPAKHGTRFFFWTV

Entity 10 Entity 10 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
Molecular weight formula_weight	15130.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MAMVKRFFESYHEVPDGTQCHRKTYITTALGGICGIIGSAYSVSLNPADSTLEAVARVGRYTFTAAAIGAMFGLTTCVSAQVREKPDDPLNYFIGGCAGGLTLGARTHSYGTAAMGCVYMGTAAALFKIGKLEGWELFPTPKV

Entity 11 Entity 11 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
Molecular weight formula_weight	8636.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MAPSVVLRSFSRLLAPARLPSCSSTRSKFYVREPVNAKPNWLAVGLSVGASVFMWIYLIQTHNEDVLEYKRRNGLE

Entity 12 Entity 12 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C2
Molecular weight formula_weight	14185.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHRQLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR

Entity 13 Entity 13 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
Molecular weight formula_weight	12675.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MPFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTRAKKECKIEFDDFEECLLRYKTMRRMHDIKKQREKLMKEGKYTPPPHHSGREEPRP

Entity 14 Entity 14 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Molecular weight formula_weight	6965.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MTLFQLLREHWVHILVPAGFVFGCYLDRKDDEKLTAFRNKSMLFQRELRPNEEVTWK

Entity 15 Entity 15 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
Molecular weight formula_weight	17463.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MAARLLSLYGRCLSAAGAMRGLPAARVRWESSRAVIAPSGVEKKRQREPTMQWQEDPEPEDENVYAKNPDFHGYDSDPVVDVWNMRAVFFFGFSIVLVFGTTFVAYVPDYRMQEWARREAERLVKYREVNGLPIMESNYFDPSKIQLPEDD

Entity 16 Entity 16 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
Molecular weight formula_weight	21742.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MAAMSLLQRASVSALTALSCRRAGPRLGVGSFLTRSFPKTVAPVRHSGDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFIDHSPKATPDN

Entity 17 Entity 17 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
Molecular weight formula_weight	15540.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNMVFKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPMRDFPDQHH

Entity 18 Entity 18 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial
Molecular weight formula_weight	11982.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MSALTRLVPFGRVGGRLLRGCRARAAGDSGVRHAGGGVHIQPRYREFPQLTRSQVIQGEFLSSLMWFWILWRFWHDSDAVLGHFSYPDPSQWTDEELGIPPDDED

Entity 19 Entity 19 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
Molecular weight formula_weight	11714.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MAAGHGHEHGHEHGHGHGKMELPDYRQWKIEGTPLETVQKKLAARGLRDPWARNEAWRYMGGFAGNITFPSVILKGFKWGFAAFVVALGAEYFLDSQNGDKKHH

Entity 20 Entity 20 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Molecular weight formula_weight	21903.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MAAARAAALGVRWLQRTTRGVVPLEARRAFHMTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLPNRSQHERDPWYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEPVVHYDI

Entity 21 Entity 21 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
Molecular weight formula_weight	15105.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MSGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHIEDPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGKLDRKFNISY

Entity 22 Entity 22 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
Molecular weight formula_weight	22020.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MAFCAPPAYLTHQQKVLRLYKRALRHLESWCIHRDKYRYFACLMRARFEEHKNEKDMMRATQLLREAEEEFWQNQHPQPYIFPDSPGGTSFERYECYKVPEWCLDYWHPSEKAMYPDYFSKREQWKKLRMESWDREVKQLQEETSPDGIMTEALPPARREGDLPPLWWHIVTRPRERPT

Entity 23 Entity 23 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
Molecular weight formula_weight	16360.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MGAHLTRRYLWDASVEPDPEKIPSFPPDLGFPERKERVMVATQQEMMDAQLTLQQRDYCAHYLIRLLKCKRDSFPNFLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKRRALKEARVAQGQGEGEVGPEVAL

Entity 24 Entity 24 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
Molecular weight formula_weight	21054.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MPDSWDKDVYPEPPSRTPAPSPQTSLPNPITYLTKAYDLVVDWPVTLVREFIERQHAKNRTYYYHRQYRRVPDITECKEGDVLCIYEAEMQWRRDFKVDQEIMNIIQERLKACQQREGENYQQNCAKELEQFTKVTKAYQDRYLDLGAYYSARKCLAKQKQRMLEERKAARQEAAA

Entity 25 Entity 25 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 26 Entity 26 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 27 Entity 27 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 28 Entity 28 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 29 Entity 29 non-polymer

Description description	;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ;
Molecular weight formula_weight	584.7 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	147426

Respiratory complex Membrane domain of CI, focus-refined of type IB, Wild type mouse under cold temperature

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acyl carrier protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer