SAXSdb — 8q5r

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-33

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Alarmin release inhibitor × 1 （A0A3P7XL18） 1,2-ETHANEDIOL × 2 CHLORIDE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IL33_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–158； UniProt 109–266

Alarmin release inhibitor

Heligmosomoides bakeri

UniProt A0A3P7XL18

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Interleukin-33 × 1 （Q8BVZ5） 1,2-ETHANEDIOL × 2 CHLORIDE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HPARI_HELPZ
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–235； UniProt 63–297

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8q5r
Deposition date deposition_date	2023-08-09
Structure title title	HpARI bound to mouse IL-33
Keywords keywords	Helminth; IL-33; anti-allergy; anti-inflammatory, IMMUNOSUPPRESSANT; IMMUNOSUPPRESSANT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8q5r__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8q5r__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8q5r__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.85 Å
Rg (electron density)	22.18 Å
Total Rg	22.94 Å
Atom count	2432
Residues	313
Excluded volume	43351 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8q5r__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Interleukin-33
Molecular weight formula_weight	17569.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2541

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKVMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Alarmin release inhibitor
Molecular weight formula_weight	25876.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

AGQRCRFTDVERDKGYTGMLLKGRLRKTAGNGRTVELICGRGNHQYTCESGVLKESSPRQARCGCKGILEMLFDMPKEERPSPMYDSVTYDPTPNTPTTVGKDGIWNGVDYRQGSTVKPYCDTGPVIQGSSKAVCVSGKWVPTLGVCPKMCSIGSLKENGKFVDVTATTKGDELNPPPREQTLIPIVRKVDKDKVQHGVKVVALCKAEDSTTAAEGVQEFECDNGKWKPEPVPCPEP

Source Source

Source organism organism	Heligmosomoides bakeri
NCBI taxonomy ID ncbi_taxonomy_id	375939
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	103

▶

Unit-cell length a length_a	149.779 Å
Unit-cell length b length_b	35.755 Å
Unit-cell length c length_c	61.289 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.07 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	48.260 Å
R factor r_factor	0.1839
R_work r_work	0.1800
R_free r_free	0.2300

HpARI bound to mouse IL-33

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-33

State in the Current Structure

Other States of the Same Protein in the Database

Alarmin release inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8q5r__assembly_1__model_1

8q5r__assembly_1__model_1 | I(q)

8q5r__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

HpARI bound to mouse IL-33

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-33

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Alarmin release inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8q5r__assembly_1__model_1

8q5r__assembly_1__model_1 | I(q)

8q5r__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)