SAXSdb — 8s05

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Conserved protein

Sulfolobus acidocaldarius DSM 639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Conserved protein × 1 （Q4J9H4） SODIUM ION × 1 ZINC ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Conserved protein × 1 （Q4J9H4） SODIUM ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4J9H3_SULAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–382； UniProt 2–380 Author chain B； PDBConstruct 4–382； UniProt 2–380

Conserved protein

Sulfolobus acidocaldarius DSM 639

UniProt Q4J9H4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Conserved protein × 1 （Q4J9H3） SODIUM ION × 1 ZINC ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Conserved protein × 1 （Q4J9H3） SODIUM ION × 1 ZINC ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4J9H4_SULAC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 19–223； UniProt 2–206 Author chain D； PDBConstruct 19–223； UniProt 2–206

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8s05
Deposition date deposition_date	2024-02-13
Last revision last_revision	2025-10-29
Structure title title	ArnAB complex an archaeal ortholog of the Sec23/24 core motif
Keywords keywords	Sequential Phosphorylation, Archaellum regulatory Network, Trafficking, Sulfolobus acidocaldarius, Sec23/Sec24, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8s05__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8s05__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8s05__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.13 Å
Rg (electron density)	22.93 Å
Total Rg	23.85 Å
Atom count	6504
Residues	408
Excluded volume	57867 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8s05__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8s05__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Conserved protein
Molecular weight formula_weight	43672.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	12981

MATTISVKAELSHKYSFTSPLKGVFRLIIVPEKVSTARGFHYIILLDTSGSMYGVKIETAKQGAMELLSRIPEGNKISFLTFSNNVNILSEYADAPSLVQQIKQIRSGGQTVLYRALERAIEIAKKHDLPGYIILLTDGQPTDVPETDAYEKLNYPEAYKVIAFGIGDDYNERLLKVITDKTAGILYHVEDAKEIAEMLPQSAVTEIGAKNVSIDIVSETQVKLLNYPGPPVKLGAVESVVRVYGEIIIPPNFTGRLATVKISYEDPLSSRINRLEVNFDITRANDVKRFLDGINNDLVNEYRYYELMSKLANQLNSNNLSEATRTVEQMQMIAQQTRRMELIETTRRISESIETTRRIGTVEQTRKISKEITSEVTKKLRSHHHHH

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Conserved protein
Molecular weight formula_weight	24982.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MWSHPQFEKLEVLFQGPSTWKCNLCGYENDDDALFCIKCGAQKSSEAQQLPQQQPSEPQAQGVVTQQQVVTNPPVQAQVATPQQPAQQPVLPQPEPAQPQPVSSTPAPQQASQPTNRYYIYFIQTPNENLVNKKVLLNFDLFPSVSMGRSPENIVIVPDSEVSRKHAVIYLDNSELYIEDLNSTNGTYVYDGKQFTPIKGKQKIEPNSIIKLGNQTIVRILKE

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	29

▶

Unit-cell length a length_a	50.100 Å
Unit-cell length b length_b	147.400 Å
Unit-cell length c length_c	62.640 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	107.16 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.110 Å
Low-resolution limit resolution_low	47.870 Å
R factor r_factor	0.2110
R_work r_work	0.2082
R_free r_free	0.2640

ArnAB complex an archaeal ortholog of the Sec23/24 core motif

1. Protein Identity and Related Structures Protein Identity & Related Structures

Conserved protein

State in the Current Structure

Other States of the Same Protein in the Database

Conserved protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8s05__assembly_1__model_1

8s05__assembly_1__model_1 | I(q)

8s05__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

ArnAB complex an archaeal ortholog of the Sec23/24 core motif

1. Protein Identity and Related Structures Protein Identity & Related Structures

Conserved protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Conserved protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8s05__assembly_1__model_1

8s05__assembly_1__model_1 | I(q)

8s05__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)