8u1h

Axle-less Bacillus sp. PS3 F1 ATPase mutant

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha

Bacillus sp. PS3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	ATP synthase subunit beta × 3 （A0A0M4U1P9） ATP synthase gamma chain × 1 （A0A0M4TPJ7） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 1 PHOSPHATE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3VGF9_BACP3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–502； UniProt 1–502 Author chain B； PDBConstruct 1–502； UniProt 1–502 Author chain C； PDBConstruct 1–502； UniProt 1–502

ATP synthase subunit beta

Bacillus sp. PS3

UniProt A0A0M4U1P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	ATP synthase subunit alpha × 3 （A0A0M3VGF9） ATP synthase gamma chain × 1 （A0A0M4TPJ7） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 1 PHOSPHATE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M4U1P9_BACP3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 12–484； UniProt 1–473 Author chain E； PDBConstruct 12–484； UniProt 1–473 Author chain F； PDBConstruct 12–484； UniProt 1–473

ATP synthase gamma chain

Bacillus sp. PS3

UniProt A0A0M4TPJ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	ATP synthase subunit alpha × 3 （A0A0M3VGF9） ATP synthase subunit beta × 3 （A0A0M4U1P9） PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 4 MAGNESIUM ION × 4 ADENOSINE-5'-DIPHOSPHATE × 1 PHOSPHATE ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M4TPJ7_BACP3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 2–263； UniProt 6–260

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8u1h
Deposition date deposition_date	2023-09-01
Structure title title	Axle-less Bacillus sp. PS3 F1 ATPase mutant
Keywords keywords	ATPase, ATP synthase, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8u1h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8u1h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8u1h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.31 Å
Rg (electron density)	41.44 Å
Total Rg	41.83 Å
Atom count	22713
Residues	2926
Excluded volume	404910 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8u1h__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit alpha
Molecular weight formula_weight	54908.7 kDa
Mutation mutation	C193S, W463F
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	22713

MSIRAEEISALIKQQIENYESQIQVSDVGTVIQVGDGIARAHGLDNVMSGELVEFANGVMGMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGPVETTETRPIESRAPGVMDRRSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAIDTIINQKDQNMISIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPYAGVAMGEYFMYKGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDIFYLHSRLLERAAKLSDAKGGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAGLSVSRVGGAAQIKAMKKVAGTLRLDLAAYRELEAFAQFGSDLDKATQAKLARGARTVEVLKQDLHQPIPVEKQVLIIYALTRGFLDDIPVEDVRRFEKEFYLFLDQNGQHLLEHIRTTKDLPNEDDLNKAIEAFKKTFVVSQ

Source Source

Source organism organism	Bacillus sp. PS3
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit beta
Molecular weight formula_weight	53424.6 kDa
Mutation mutation	Addition of His10 tag on N-term
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MHHHHHHHHHHMTRGRVIQVMGPVVDVKFENGHLPAIYNALKIQHKARNENEVDIDLTLEVALHLGDDTVRTIAMASTDGLIRGMEVIDTGAPISVPVGEVTLGRVFNVLGEPIDLEGDIPADARRDPIHRPAPKFEELATEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELIHNIAQEHGGISVFAGVGERTREGNDLYHEMKDSGVISKTAMVFGQMNEPPGARMRVALTGLTMAEYFRDEQGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTAKGSITSIQAIYVPADDYTDPAPATTFSHLDATTNLERKLAEMGIYPAVDPLASTSRALAPEIVGEEHYQVARKVQQTLQRYKELQDIIAILGMDELSDEDKLVVHRARRIQFFLSQNFHVAEQFTGQPGSYVPVKETVRGFKEILEGKYDHLPEDAFRLVGRIEEVVEKAKAMGVEV

Source Source

Source organism organism	Bacillus sp. PS3
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	ATP synthase gamma chain
Molecular weight formula_weight	29677.1 kDa
Mutation mutation	S109C, I212C
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDIKTRINATKKTSQITKAMEMVSTSKLNRAEQNAKSFVPYMEKIQEVVANVALGAGGASHPMLVSRPVKKTGYLVITSDRGLAGAYNSNVLRLVYQTIQKRHACPDEYAIIVIGRVGLSFFRKRNMPVILDITRLPDQPSFADIKEIARKTVGLFADGTFDELYMYYNHYVSAIQQEVTERKLLPLTDLAENWSHPQFEKQRTVYEFEPSQEECLDVLLPQYAESLIYGALLDAKASEHAARMTAMKNATDNANELIRTLTL

Source Source

Source organism organism	Bacillus sp. PS3
NCBI taxonomy ID ncbi_taxonomy_id	2334
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	506.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	23813

Axle-less Bacillus sp. PS3 F1 ATPase mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

ATP synthase gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8u1h__assembly_1__model_1

8u1h__assembly_1__model_1 | I(q)

8u1h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)

Axle-less Bacillus sp. PS3 F1 ATPase mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8u1h__assembly_1__model_1

8u1h__assembly_1__model_1 | I(q)

8u1h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)