8vwi

The base complex of the AcMNPV baculovirus nucleocapsid (Class 1, localised reconstruction)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

Autographa californica multiple nucleopolyhedrovirus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Capsid-associated protein VP80 × 6 （Q00733） Occlusion-derived virus envelope protein E27 × 6 （P41702） Protein C42 × 6 （P25695） Protein AC109 × 2 （P41662） Protein AC142 × 2 （P41700） 38K (AC98) protein in P143-LEF5 intergenic region × 2 （P24745） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCP_NPVAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–347； UniProt 1–347 Author chain B； PDBConstruct 1–347； UniProt 1–347 Author chain C； PDBConstruct 1–347； UniProt 1–347 Author chain D； PDBConstruct 1–347； UniProt 1–347 Author chain E； PDBConstruct 1–347； UniProt 1–347 Author chain F； PDBConstruct 1–347； UniProt 1–347 Author chain V； PDBConstruct 1–347； UniProt 1–347 Author chain W； PDBConstruct 1–347； UniProt 1–347 Author chain X； PDBConstruct 1–347； UniProt 1–347 Author chain Y； PDBConstruct 1–347； UniProt 1–347 Author chain Z； PDBConstruct 1–347； UniProt 1–347 Author chain a； PDBConstruct 1–347； UniProt 1–347

Capsid-associated protein VP80

Autographa californica multiple nucleopolyhedrovirus

UniProt Q00733

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Major capsid protein × 12 （P17499） Occlusion-derived virus envelope protein E27 × 6 （P41702） Protein C42 × 6 （P25695） Protein AC109 × 2 （P41662） Protein AC142 × 2 （P41700） 38K (AC98) protein in P143-LEF5 intergenic region × 2 （P24745） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VP80_NPVAC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–691； UniProt 1–691 Author chain H； PDBConstruct 1–691； UniProt 1–691 Author chain I； PDBConstruct 1–691； UniProt 1–691 Author chain b； PDBConstruct 1–691； UniProt 1–691 Author chain c； PDBConstruct 1–691； UniProt 1–691 Author chain d； PDBConstruct 1–691； UniProt 1–691

Occlusion-derived virus envelope protein E27

Autographa californica multiple nucleopolyhedrovirus

UniProt P41702

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Major capsid protein × 12 （P17499） Capsid-associated protein VP80 × 6 （Q00733） Protein C42 × 6 （P25695） Protein AC109 × 2 （P41662） Protein AC142 × 2 （P41700） 38K (AC98) protein in P143-LEF5 intergenic region × 2 （P24745） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E27_NPVAC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–290； UniProt 1–290 Author chain M； PDBConstruct 1–290； UniProt 1–290 Author chain Q； PDBConstruct 1–290； UniProt 1–290 Author chain S； PDBConstruct 1–290； UniProt 1–290 Author chain e； PDBConstruct 1–290； UniProt 1–290 Author chain h； PDBConstruct 1–290； UniProt 1–290

Protein C42

Autographa californica multiple nucleopolyhedrovirus

UniProt P25695

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Major capsid protein × 12 （P17499） Capsid-associated protein VP80 × 6 （Q00733） Occlusion-derived virus envelope protein E27 × 6 （P41702） Protein AC109 × 2 （P41662） Protein AC142 × 2 （P41700） 38K (AC98) protein in P143-LEF5 intergenic region × 2 （P24745） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C42_NPVAC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–361； UniProt 1–361 Author chain L； PDBConstruct 1–361； UniProt 1–361 Author chain R； PDBConstruct 1–361； UniProt 1–361 Author chain T； PDBConstruct 1–361； UniProt 1–361 Author chain f； PDBConstruct 1–361； UniProt 1–361 Author chain g； PDBConstruct 1–361； UniProt 1–361

Protein AC109

Autographa californica multiple nucleopolyhedrovirus

UniProt P41662

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Major capsid protein × 12 （P17499） Capsid-associated protein VP80 × 6 （Q00733） Occlusion-derived virus envelope protein E27 × 6 （P41702） Protein C42 × 6 （P25695） Protein AC142 × 2 （P41700） 38K (AC98) protein in P143-LEF5 intergenic region × 2 （P24745） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AC109_NPVAC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain N； PDBConstruct 1–390； UniProt 1–390 Author chain i； PDBConstruct 1–390； UniProt 1–390

Protein AC142

Autographa californica multiple nucleopolyhedrovirus

UniProt P41700

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Major capsid protein × 12 （P17499） Capsid-associated protein VP80 × 6 （Q00733） Occlusion-derived virus envelope protein E27 × 6 （P41702） Protein C42 × 6 （P25695） Protein AC109 × 2 （P41662） 38K (AC98) protein in P143-LEF5 intergenic region × 2 （P24745） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AC142_NPVAC
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain O； PDBConstruct 1–477； UniProt 1–477 Author chain j； PDBConstruct 1–477； UniProt 1–477

38K (AC98) protein in P143-LEF5 intergenic region

Autographa californica multiple nucleopolyhedrovirus

UniProt P24745

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Major capsid protein × 12 （P17499） Capsid-associated protein VP80 × 6 （Q00733） Occlusion-derived virus envelope protein E27 × 6 （P41702） Protein C42 × 6 （P25695） Protein AC109 × 2 （P41662） Protein AC142 × 2 （P41700） ZINC ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	38K_NPVAC
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain P； PDBConstruct 1–320； UniProt 1–320 Author chain k； PDBConstruct 1–320； UniProt 1–320

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8vwi
Deposition date deposition_date	2024-02-01
Structure title title	The base complex of the AcMNPV baculovirus nucleocapsid (Class 1, localised reconstruction)
Keywords keywords	Nucleocapsid, Base, baculovirus, virus, AcMNPV, VP39, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8vwi__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8vwi__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8vwi__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	84.99 Å
Rg (electron density)	84.57 Å
Total Rg	84.60 Å
Atom count	156266
Residues	9602
Excluded volume	1405200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8vwi__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Major capsid protein
Molecular weight formula_weight	38991.1 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,V,W,X,Y,Z,a
Atom count atom_count	156266

MALVPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNNHLIKRFKMSKMVLPIFDEDDNQFKMTIARHLVGNKERGIKRILIPSATNYQDVFNLNSMMQAEQLIFHLIYNNENAVNTICDNLKYTEGFTSNTQRVIHSVYATTKSILDTTNPNTFCSRVSRDELRFFDVTNARALRGGAGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNCATCIIDETGLVASVPDGPELYNPIRSSDIMRSQPNRLQIRNVLKFEGDTRELDRTLSGYEEYPTYVPLFLGYQIINSENNFLRNDFIPRANPNATLGGGAVAGPAPGVAGEAGGGIAV

Source Source

Source organism organism	Autographa californica multiple nucleopolyhedrovirus
NCBI taxonomy ID ncbi_taxonomy_id	307456
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Capsid-associated protein VP80
Molecular weight formula_weight	79974.5 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,b,c,d

MNDSNSLLITRLAAQILSRNMQTVDVIVDDKTLSLEEKIDTLTSMVLAVNSPPQSPPRVTSSDLAASIIKNNSKMVGNDFEMRYNVLRMAVVFVKHYPKYYNETTAGLVAEIESNLLQYQNYVNQGNYQNIEGYDSLLNKAEECYVKIDRLFKESIKKIMDDTEAFEREQEAERLRAEQTAANALLERRAQTSADDVVNRADANIPTAFSDPLPGPSAPRYMYESSESDTYMETARRTAEHYTDQDKDYNAAYTADEYNSLVKTVLLRLIEKALATLKNRLHITTIDQLKKFRDYLNSDADAGEFQIFLNQEDCVILKNLSNLASKFFNVRCVADTLEVMLEALRNNIELVQPESDAVRRIVIKMTQEIKDSSTPLYNIAMYKSDYDAIKNKNIKTLFDLYNDRLPINFLDTSATSPVRKTSGKRSAEDDLLPTRSSKRANRPEINVISSEDEQEDDDVEDVDYEKESKRRKLEDEDFLKLKALEFSKDIVNEKLQKIIVVTDGMKRLYEYCNCKNSLETLPSAANYGSLLKRLNLYNLDHIEMNVNFYELLFPLTLYNDNDNSDKTLSHQLVNYIFLASNYFQNCAKNFNYMRETFNVFGPFKQIDFMVMFVIKFNFLCDMRNFAKLIDELVPNKQPNMRIHSVLVMRDKIVKLAFSNLQFQTFSKKDKSRNTKHLQRLIMLMNANYNVI

Source Source

Source organism organism	Autographa californica multiple nucleopolyhedrovirus
NCBI taxonomy ID ncbi_taxonomy_id	307456
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	Occlusion-derived virus envelope protein E27
Molecular weight formula_weight	33568.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,M,Q,S,e,h

MKRIKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKADTRQIAAVVFSTLAFIHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILFTENEGVLLCSVDRPSIVKMLSREFDTEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNKQPNYDMDLSDFSITEVEATQYLTLLLTVEHAYLHYYIFKNYGVFEYCKSLTDHSLFTNKLRSTMSTKTSNLLLSKFKFTIEDFDKINSNSVTSGFNIYNFNK

Source Source

Source organism organism	Autographa californica multiple nucleopolyhedrovirus
NCBI taxonomy ID ncbi_taxonomy_id	307456
Host organism host_organism	Spodoptera frugiperda

Entity 4 Entity 4 polymer

Description description	Protein C42
Molecular weight formula_weight	41583.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,R,T,f,g

MSAIALYLEINKLRLKIDEPMQLAIWPQLFPLLCDEHQSVQLNTDVLINFMMHVARKSQNTILNNNAAIASQYAAGNADVVAAPASAQPTPRPVINLFARANAAAPAQPSEELINMRRYRNAARKLIHHYSLNSTSSTEYKISDVVMTMIFLLRSEKYHSLFKLLETTFDDYTCRPQMTQVQTDTLLDAVRSLLEMPSTTIDLTTVDIMRSSFARCFNSPIMRYAKIVLLQNVALQRDKRTTLEELLIERGEKIQMLQPQQYINSGTEIPFCDDAEFLNRLLKHIDPYPLSRMYYNAANTMFYTTMENYAVSNCKFNIEDYNNIFKVMENIRKHSNKNSNDQDELNIYLGVQSSNAKRKKY

Source Source

Source organism organism	Autographa californica multiple nucleopolyhedrovirus
NCBI taxonomy ID ncbi_taxonomy_id	307456
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 polymer

Description description	Protein AC109
Molecular weight formula_weight	44851.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,i

MECPFQIQVCISDRFFAFPHNLVEPQSDVGNKLIENLIVYVPTDDDRLYIDKKQFPKFNSVLVYRHEHDVNIDSRSPKKTASATIVYWNPLVPITEIGAGETRVFSVLLTNNLFYCNTMIVHHENPKCPIEFTYPETDMQSACSALLKNRNGQSVPPPIKSNLRPIACEIPLSHFKELVESNDFLLCFNLETSTMVKILSLKRIFCIFQYRKQPARYVINLPHEEIDNLYNKLNWERTRRLMKGDVPSNCATVNRSSLKYIKQAQSLLGIPDYSQTVVDFVKMFQKIIFPYQLVPNVIIKLNNFDQMVSSAPNKAEPYKKIRLFCKNDSIAISSSGIVPINMPDFSPPNTFDYSDYANRTNINFVTQRVLTDGGFSSGITVTPVKYNYYL

Source Source

Source organism organism	Autographa californica multiple nucleopolyhedrovirus
NCBI taxonomy ID ncbi_taxonomy_id	307456
Host organism host_organism	Spodoptera frugiperda

Entity 6 Entity 6 polymer

Description description	Protein AC142
Molecular weight formula_weight	55480.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,j

MSGGGNLLTLERDHFKYLFLTSYFDLKDNEHVPSEPMAFIRNYLNCTFDLLDDAVLMNYFNYLQSMQLKHLVGSTSTNIFKFVKPQFRFVCDRTTVDILEFDTRMYIKPGTPVYATNLFTSNPRKMMAFLYAEFGKVFKNKIFVNINNYGCVLAGSAGFLFDDAYVDWNGVRMCAAPRLDNNMHPFRLYLLGEDMAKHFVDNNILPPHPSNAKTRKINNSMFMLKNFYKGLPLFKSKYTVVNSTKIVTRKPNDIFNEIDKELNGNCPFIKFIQRDYIFDAQFPPDLLDLLNEYMTKSSIMKIITKFVIEENPAMSGEMSREIILDRYSVDNYRKLYIKMEITNQFPVMYDHESSYIFVSKDFLQLKGTMNAFYAPKQRILSILAVNRLFGATETIDFHPNLLVYRQSSPPVRLTGDVYVVDKNEKVFLVKHVFSNTVPAYLLIRGDYESSSDLKSLRDLNPWVQNTLLKLLIPDSVQ

Source Source

Source organism organism	Autographa californica multiple nucleopolyhedrovirus
NCBI taxonomy ID ncbi_taxonomy_id	307456
Host organism host_organism	Spodoptera frugiperda

Entity 7 Entity 7 polymer

Description description	38K (AC98) protein in P143-LEF5 intergenic region
Molecular weight formula_weight	38070.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,k

MASSLQSKWICLRLNDAIIKRHVLVLSEYADLKYLGFEKYKFFEYVIFQFCNDPQLCKIIENNYNYCMQIFKAPADDMRDIRHNIKRAFKTPVLGHMCVLSNKPPMYSFLKEWFLLPHYKVVSLKSESLTWGFPHVVVFDLDSTLITEEEQVEIRDPFVYDSLQELHEMGCVLVLWSYGSRDHVAHSMRDVDLEGYFDIIISEGSTVQEERSDLVQNSHNAIVDYNLKKRFIENKFVFDIHNHRSDNNIPKSPKIVIKYLSDKNVNFFKSITLVDDLPTNNYAYDFYVKVKRCPTPVQDWEHYHNEIIQNIMDYEQYFIK

Source Source

Source organism organism	Autographa californica multiple nucleopolyhedrovirus
NCBI taxonomy ID ncbi_taxonomy_id	307456
Host organism host_organism	Spodoptera frugiperda

Entity 8 Entity 8 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	12

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.71 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	53750

The base complex of the AcMNPV baculovirus nucleocapsid (Class 1, localised reconstruction)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid-associated protein VP80

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Occlusion-derived virus envelope protein E27

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein C42

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein AC109

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein AC142

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

38K (AC98) protein in P143-LEF5 intergenic region

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8vwi__assembly_1__model_1

8vwi__assembly_1__model_1 | I(q)

8vwi__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source