SAXSdb — 8ws1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serine/threonine-protein kinase Nek7

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–302 Chain B； UniProt 1–302	Mutation：D161N	EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；294 K；0.1 M Tris pH 8.4, PEG 8000 15%	Resolution 2.40 Å R-free 0.238

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8WS1	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2WQM Structure of apo human Nek7 Deposited 2009-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–302（302 aa）	Not recorded	SO4 SULFATE ION × 1 NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 100 MM HEPES, PH 7.5, 15% PEG 5000 MME, 400 MM AMMONIUM SULFATE	Resolution 2.10 Å R-free 0.215
2WQN Structure of ADP-bound human Nek7 Deposited 2009-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–302（302 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 NI NICKEL (II) ION × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions 100MM HEPES 7.5, 15% PEG 5000MME, 400MM AMMONIUM SULFATE	Resolution 2.30 Å R-free 0.221
5DE2 Structural mechanism of Nek7 activation by Nek9-induced dimerisation Deposited 2015-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–302（302 aa）	Mutation：Y97F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；The composition of the reservoir buffer was: 0.2M Potassium thiocyanate, 0.1M Bis-Tris propane pH 7.5, 20% (w/v) PEG 3350.	Resolution 2.78 Å R-free 0.254
5DE2 Structural mechanism of Nek7 activation by Nek9-induced dimerisation Deposited 2015-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–302（302 aa）	Mutation：Y97F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；The composition of the reservoir buffer was: 0.2M Potassium thiocyanate, 0.1M Bis-Tris propane pH 7.5, 20% (w/v) PEG 3350.	Resolution 2.78 Å R-free 0.254
6NPY Cryo-EM structure of NLRP3 bound to NEK7 Deposited 2019-01-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 34–302（269 aa）	Mutation：L54R,V58K,P59T,K87A,A99V,S100C,E103T,D104G	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
6S73 Crystal structure of Nek7 SRS mutant bound to compound 51 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–302（302 aa）	Mutation：L86H, Y97F, L180F	F9N 3-[[6-(cyclohexylmethoxy)-7~{H}-purin-2-yl]amino]-~{N}-[3-(dimethylamino)propyl]benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.02 M Sodium/potassium phosphate, 0.1 M Bis-Tris propane pH 6.5, 20 % w/v PEG 3350	Resolution 3.50 Å R-free 0.271
6S73 Crystal structure of Nek7 SRS mutant bound to compound 51 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–302（302 aa）	Mutation：L86H, Y97F, L180F	F9N 3-[[6-(cyclohexylmethoxy)-7~{H}-purin-2-yl]amino]-~{N}-[3-(dimethylamino)propyl]benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.02 M Sodium/potassium phosphate, 0.1 M Bis-Tris propane pH 6.5, 20 % w/v PEG 3350	Resolution 3.50 Å R-free 0.271
6S73 Crystal structure of Nek7 SRS mutant bound to compound 51 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–302（302 aa）	Mutation：L86H, Y97F, L180F	F9N 3-[[6-(cyclohexylmethoxy)-7~{H}-purin-2-yl]amino]-~{N}-[3-(dimethylamino)propyl]benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.02 M Sodium/potassium phosphate, 0.1 M Bis-Tris propane pH 6.5, 20 % w/v PEG 3350	Resolution 3.50 Å R-free 0.271
6S73 Crystal structure of Nek7 SRS mutant bound to compound 51 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–302（302 aa）	Mutation：L86H, Y97F, L180F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.02 M Sodium/potassium phosphate, 0.1 M Bis-Tris propane pH 6.5, 20 % w/v PEG 3350	Resolution 3.50 Å R-free 0.271
6S75 Crystal structure of Nek7 bound to compound 51 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–302（302 aa）	Not recorded	F9N 3-[[6-(cyclohexylmethoxy)-7~{H}-purin-2-yl]amino]-~{N}-[3-(dimethylamino)propyl]benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；20 % w/v Polyethylene glycol 3,350, 150 mM di-Sodium DL-malate; pH 7.0, 3% w/v 1,6-Hexanediol	Resolution 3.30 Å R-free 0.317
6S75 Crystal structure of Nek7 bound to compound 51 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–302（302 aa）	Not recorded	F9N 3-[[6-(cyclohexylmethoxy)-7~{H}-purin-2-yl]amino]-~{N}-[3-(dimethylamino)propyl]benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；20 % w/v Polyethylene glycol 3,350, 150 mM di-Sodium DL-malate; pH 7.0, 3% w/v 1,6-Hexanediol	Resolution 3.30 Å R-free 0.317
6S75 Crystal structure of Nek7 bound to compound 51 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–302（302 aa）	Not recorded	F9N 3-[[6-(cyclohexylmethoxy)-7~{H}-purin-2-yl]amino]-~{N}-[3-(dimethylamino)propyl]benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；20 % w/v Polyethylene glycol 3,350, 150 mM di-Sodium DL-malate; pH 7.0, 3% w/v 1,6-Hexanediol	Resolution 3.30 Å R-free 0.317
6S75 Crystal structure of Nek7 bound to compound 51 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–302（302 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；20 % w/v Polyethylene glycol 3,350, 150 mM di-Sodium DL-malate; pH 7.0, 3% w/v 1,6-Hexanediol	Resolution 3.30 Å R-free 0.317
6S76 Crystal structure of human Nek7 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–302（302 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；20 % w/v Polyethylene glycol 3,350, 150 mM di-Sodium DL-malate; pH 7.0	Resolution 3.38 Å R-free 0.286
6S76 Crystal structure of human Nek7 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–302（302 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；20 % w/v Polyethylene glycol 3,350, 150 mM di-Sodium DL-malate; pH 7.0	Resolution 3.38 Å R-free 0.286
6S76 Crystal structure of human Nek7 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–302（302 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；20 % w/v Polyethylene glycol 3,350, 150 mM di-Sodium DL-malate; pH 7.0	Resolution 3.38 Å R-free 0.286
6S76 Crystal structure of human Nek7 Deposited 2019-07-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–302（302 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；20 % w/v Polyethylene glycol 3,350, 150 mM di-Sodium DL-malate; pH 7.0	Resolution 3.38 Å R-free 0.286
8EJ4 Cryo-EM structure of the active NLRP3 inflammasome disk Deposited 2022-09-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 20 PDB declaration: eicosameric	Chain K 20–297（278 aa） Chain L 20–297（278 aa） Chain M 20–297（278 aa） Chain N 20–297（278 aa） Chain O 20–297（278 aa） Chain P 20–297（278 aa） Chain Q 20–297（278 aa） Chain R 20–297（278 aa） Chain S 20–297（278 aa） Chain T 20–297（278 aa）	Not recorded	AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 10 MG MAGNESIUM ION × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8SXN Structure of NLRP3 and NEK7 complex Deposited 2023-05-22	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–302（302 aa） Chain B 1–302（302 aa）	Not recorded	7YN 1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-(1,2,3,5-tetrahydro-s-indacen-4-yl)urea × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.04 Å
8WS0 Crystal structure of human NEK7 S195D mutant Deposited 2023-10-16	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–302（302 aa） Chain B 1–302（302 aa）	Mutation：S195D Mutation：S195D	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1 M Tris pH 8.5, 20% PEG 3350	Resolution 2.12 Å R-free 0.242
9H59 Cryo-EM structure of DDB1-CRBN in complex with NK7-902 and NEK7 Deposited 2024-10-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–302（302 aa）	Not recorded	A1ISP 2-[(3S)-2,6-bis(oxidanylidene)piperidin-3-yl]-5-[(1S,2R,5S)-2-(ethylamino)-8-azabicyclo[3.2.1]octan-8-yl]isoindole-1,3-dione × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9NFQ Crystal structure of CRBN-DDB1 and MRT-3486 in complex with NEK7 Deposited 2025-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–302（302 aa）	Not recorded	A1BX6 (3S)-N-{[(4R)-3-(2,4-dioxo-1,3-diazinan-1-yl)imidazo[1,2-a]pyridin-7-yl]methyl}-2-(phenylmethanesulfonyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide × 1 ZN ZINC ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.029 M HEPES salt, 0.071 M MOPS acid, 0.06 M NaNO3, 0.06 M Na2HPO4, 0.06 M (NH4)2SO4, 11 % (w/v) PEG 8,000 and 25 % (v/v) ethylene glycol.	Resolution 3.25 Å R-free 0.261

12 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NEK7_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–302； UniProt 1–302 Author chain B； PDBConstruct 1–302； UniProt 1–302

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ws1
Deposition date deposition_date	2023-10-16
最后修订 last_revision	2025-04-16
Structure title title	Crystal structure of human NEK7 D161N mutant
Keywords keywords	Kinase, Complex, autoinhibitory, human, inflammasomes, CELL CYCLE; CELL CYCLE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	26.75 Å
Radius of gyration Rg (electron density) rg_electron	25.70 Å
Forward intensity I(0) i0	62085800.00
Molecular weight molecular_weight	62237.0 kDa
Excluded volume excluded_volume	78342 Å³
Envelope volume envelope_volume	96299 Å³
Hydration-shell volume shell_volume	31050 Å³
Envelope diameter envelope_diameter	95.9 Å
Shell Rg shell_rg	33.10 Å
Envelope Rg envelope_rg	25.82 Å
Shape Rg shape_rg	25.68 Å
Total Rg total_rg	26.55 Å
Total atoms total_atoms	4367
Residues n_residues	538
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	88.4 Å
Rg (real space) rg_real	26.69 Å
Rg uncertainty (real space) rg_real_error	0.71 Å
I(0) (real space) i0_real	6.2090e+07
I(0) uncertainty (real space) i0_real_error	9.4610e+05
Rg (reciprocal space) rg_reciprocal	26.71 Å
I(0) (reciprocal space) i0_reciprocal	62090000.0000
Solution quality estimate total_estimate	0.8097
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	31.4 Å
Skewness Skewness skewness	0.306
Kurtosis Kurtosis kurtosis	-0.309
Angular range angular_range	— – 0.2950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	12830000.0000
Real-space data points n_real_points	60
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.845; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.991; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Serine/threonine-protein kinase Nek7
Molecular weight formula_weight	35669.1 kDa
EC 编号 ec_number	2.7.11.34
Mutation mutation	D161N
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4557

MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRNIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASSLEHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	176

▶

8. Citations (1)

▶

Unit-cell length a length_a	87.894 Å
Unit-cell length b length_b	87.894 Å
Unit-cell length c length_c	155.319 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	43.990 Å
R factor r_factor	0.1823
R_work r_work	0.1793
R_free r_free	0.2384

fit	/app/data/saxs_computation/ws/8ws1/8ws1.fit
pddf	/app/data/pr_computation/ws/8ws1/8ws1.pr.out
profile	/app/data/saxs_computation/ws/8ws1/8ws1.dat

Crystal structure of human NEK7 D161N mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serine/threonine-protein kinase Nek7

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction