SAXSdb — 9bif

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer surface protein C

Borreliella burgdorferi B31

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	VH-CH1 domain of B11 Fab × 2 VH-VL domain of B11 Fab × 2 PRASEODYMIUM ION × 2 CHLORIDE ION × 1 water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	VH-CH1 domain of B11 Fab × 2 VH-VL domain of B11 Fab × 2 PRASEODYMIUM ION × 2 water × 6	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 6	VH-CH1 domain of B11 Fab × 2 VH-VL domain of B11 Fab × 2 PRASEODYMIUM ION × 2 CHLORIDE ION × 1 water × 6	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 6	VH-CH1 domain of B11 Fab × 2 VH-VL domain of B11 Fab × 2 PRASEODYMIUM ION × 2 CHLORIDE ION × 4 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OSPC_BORBU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–164； UniProt 38–201 Author chain B； PDBConstruct 1–164； UniProt 38–201 Author chain E； PDBConstruct 1–164； UniProt 38–201 Author chain F； PDBConstruct 1–164； UniProt 38–201 Author chain M； PDBConstruct 1–164； UniProt 38–201 Author chain N； PDBConstruct 1–164； UniProt 38–201 Author chain S； PDBConstruct 1–164； UniProt 38–201 Author chain T； PDBConstruct 1–164； UniProt 38–201

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9bif
Deposition date deposition_date	2024-04-23
Last revision last_revision	2024-11-20
Structure title title	Fab B11-OspCA complex
Keywords keywords	anti-OspCA monoclonal antibody, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9bif__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9bif__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9bif__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.95 Å
Rg (electron density)	43.61 Å
Total Rg	43.44 Å
Atom count	8849
Residues	1169
Excluded volume	157330 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9bif__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9bif__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`9bif__assembly_3__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`9bif__assembly_4__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	VH-CH1 domain of B11 Fab
Molecular weight formula_weight	24161.1 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,C,G,J,O,Q,U,W
Atom count atom_count	35581

QLQLQESGPGLVKPSQTLSLTCTLSGGSISSTSYYWGWIRQPPGSGLEWIGSMYHSGNTYYKSSLKGRVTISLDTSRTQFSLRLTSVTAADTAVYYCARLGDVFNSAMDVWGQGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	VH-VL domain of B11 Fab
Molecular weight formula_weight	23641.2 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,D,I,K,P,R,V,X

EIVMTQSPVTLSVSPGERATLSCRASQSVGNNLAWYQHKPGQAPRLLIYDASTRATGIPGRFSGSGSGTEFTLTISSLQSEDFAVYYCQEYNNWPRYTFGQGAKLEIRRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Outer surface protein C
Molecular weight formula_weight	17528.0 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,F,M,N,S,T

KGPNLTEISKKITDSNAVLLAVKEVEALLSSIDEIAAKAIGKKIHQNNGLDTENNHNGSLLAGAYAISTLIKQKLDGLKNEGLKEKIDAAKKCSETFTNKLKEKHTDLGKEGVTDADAKEAILKTNGTKTKGAEELGKLFESVEVLSKAAKEMLANSVKELTSP

Source Source

Source organism organism	Borreliella burgdorferi B31
NCBI taxonomy ID ncbi_taxonomy_id	224326
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	PRASEODYMIUM ION
Molecular weight formula_weight	140.9 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 5 Entity 5 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	220

▶

Unit-cell length a length_a	96.737 Å
Unit-cell length b length_b	97.294 Å
Unit-cell length c length_c	168.343 Å
Unit-cell angle α angle_alpha	97.60 °
Unit-cell angle β angle_beta	90.27 °
Unit-cell angle γ angle_gamma	106.21 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.090 Å
Low-resolution limit resolution_low	48.620 Å
R factor r_factor	0.2425
R_work r_work	0.2398
R_free r_free	0.2950

Fab B11-OspCA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer surface protein C

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9bif__assembly_2__model_1

9bif__assembly_2__model_1 | I(q)

9bif__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

Fab B11-OspCA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer surface protein C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9bif__assembly_2__model_1

9bif__assembly_2__model_1 | I(q)

9bif__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)