SAXSdb — 9bjh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apical membrane antigen 1

Plasmodium falciparum 3D7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	75C8 Fab Heavy Chain × 1 75C8 Fab Light Chain × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	75C8 Fab Heavy Chain × 1 75C8 Fab Light Chain × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7KQK5_PLAF7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–338； UniProt 104–438 Author chain B； PDBConstruct 4–338； UniProt 104–438

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9bjh
Deposition date deposition_date	2024-04-25
Structure title title	Crystal structure of neutralizing human monoclonal antibody 75C8 in complex with AMA1 DI-DII
Keywords keywords	Apical membrane antigen 1, AMA1, Plasmodium, Malaria, Antigen-Antibody complex, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9bjh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9bjh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9bjh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.97 Å
Rg (electron density)	33.89 Å
Total Rg	34.30 Å
Atom count	11070
Residues	721
Excluded volume	99519 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9bjh__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9bjh__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Apical membrane antigen 1
Molecular weight formula_weight	39655.5 kDa
Mutation mutation	T64A, T188A, S273A, S323A, S324A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	22075

ETGNYMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTAFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAKDISFQNYAYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNAAMIKSAFLPTGAFKADRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNAAYIATTALSHPIEVEGTKHHHHHH

Source Source

Source organism organism	Plasmodium falciparum 3D7
NCBI taxonomy ID ncbi_taxonomy_id	36329
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	75C8 Fab Heavy Chain
Molecular weight formula_weight	25852.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I

MGIQVQLRESGPHLVKPSETLSLTCNVSGGTINRYYWNWIRQIPGKGLEWIGNIYYTGTTETNPSLEGRPLISIDRTTQQVSLTLTSVTPADTAVYYCARTRGEWSPDWCLDRWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGGSHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	75C8 Fab Light Chain
Molecular weight formula_weight	23993.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M

MGIEIVLTQSPDTLSLSPGDTATLSCRASQTITNAYFAWYQQKPGQAPRLLIYSTSTRASGIPDRFSGSGSGTEFTLTISRLEPEDFAVFYCQQYVRSPWTFGQGTKVELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	21

▶

Unit-cell length a length_a	54.868 Å
Unit-cell length b length_b	71.620 Å
Unit-cell length c length_c	132.927 Å
Unit-cell angle α angle_alpha	94.11 °
Unit-cell angle β angle_beta	99.19 °
Unit-cell angle γ angle_gamma	112.39 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	19.870 Å
R factor r_factor	0.2128
R_work r_work	0.2107
R_free r_free	0.2529

Crystal structure of neutralizing human monoclonal antibody 75C8 in complex with AMA1 DI-DII

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apical membrane antigen 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9bjh__assembly_1__model_1

9bjh__assembly_1__model_1 | I(q)

9bjh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of neutralizing human monoclonal antibody 75C8 in complex with AMA1 DI-DII

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apical membrane antigen 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9bjh__assembly_1__model_1

9bjh__assembly_1__model_1 | I(q)

9bjh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

7. Citations (1)