SAXSdb — 9c2h

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

Severe acute respiratory syndrome coronavirus 2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	Antibody Fab NP3-B4 Heavy Chain (variable region) × 2 Antibody Fab NP3-B4 Light Chain (variable region) × 2 Antibody Fab NP1-E9 Heavy Chain (variable region) × 2 Antibody Fab NP1-E9 Light Chain (variable region) × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCAP_SARS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 24–144； UniProt 244–364 Author chain D； PDBConstruct 24–144； UniProt 244–364

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9c2h
Deposition date deposition_date	2024-05-31
Structure title title	SARS-CoV-2 Nucleocapsid Dimerization Domain bound to Fab-NP1E9 and Fab-NP3B4
Keywords keywords	Protein, Fab, immunocomplex, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9c2h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9c2h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9c2h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.19 Å
Rg (electron density)	36.95 Å
Total Rg	37.55 Å
Atom count	8626
Residues	1110
Excluded volume	152480 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9c2h__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Nucleoprotein
Molecular weight formula_weight	16422.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	8626

MAHHHHHHVDDDDKMENLYFQGMQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP

Source Source

Source organism organism	Severe acute respiratory syndrome coronavirus 2
NCBI taxonomy ID ncbi_taxonomy_id	2697049
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Antibody Fab NP3-B4 Heavy Chain (variable region)
Molecular weight formula_weight	26549.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G

EVQLVESGGGLVQPGGSVKLSCLASGFTFSDYYMSWVRQSPEKGLEWVAEIRLESDNYATHYAESVKGKFTISRDDSKSRLYLKMNSLRGEDTGIYYCAFDVYYGGAMDYWGQGTTVTVEVQLVESGGGLVQPGGSVKLSCLASGFTFSDYYMSWVRQSPEKGLEWVAEIRLESDNYATHYAESVKGKFTISRDDSKSRLYLKMNSLRGEDTGIYYCAFDVYYGGAMDYWGQGTTVTV

Source Source

Source organism organism	Mus sp.
NCBI taxonomy ID ncbi_taxonomy_id	10095
Host organism host_organism	Cricetulus griseus

Entity 3 Entity 3 polymer

Description description	Antibody Fab NP3-B4 Light Chain (variable region)
Molecular weight formula_weight	11548.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,H

CDIQMTQSPSIMSASPGEKVTMTCSASSSVSYMHWYQQKSSTSPKLWIYDTSELASGVPGRFSGSRSGNSYSLTISSMEAEDVATYYCFQGSGYPLTFGGGTKLELK

Source Source

Source organism organism	Mus sp.
NCBI taxonomy ID ncbi_taxonomy_id	10095
Host organism host_organism	Cricetulus griseus

Entity 4 Entity 4 polymer

Description description	Antibody Fab NP1-E9 Heavy Chain (variable region)
Molecular weight formula_weight	12557.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,I

QVQLQQSGPELVKPGTLVKISCKASGYTFTSYDINWVKQRPGQGLEWIGWIYPGDGSTKYNEKFKGKATLTADTSSSTAYMQLNSLTSENSAVYFCARGLVGAMDYWGQGTSVTV

Source Source

Source organism organism	Mus sp.
NCBI taxonomy ID ncbi_taxonomy_id	10095
Host organism host_organism	Cricetulus griseus

Entity 5 Entity 5 polymer

Description description	Antibody Fab NP1-E9 Light Chain (variable region)
Molecular weight formula_weight	11853.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,J

DIVMTQSQKFMSTSVGDRVSVTCKASQNVLNNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYNSYPLTFGDGTKLELK

Source Source

Source organism organism	Mus sp.
NCBI taxonomy ID ncbi_taxonomy_id	10095
Host organism host_organism	Cricetulus griseus

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	632077

SARS-CoV-2 Nucleocapsid Dimerization Domain bound to Fab-NP1E9 and Fab-NP3B4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9c2h__assembly_1__model_1

9c2h__assembly_1__model_1 | I(q)

9c2h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)

SARS-CoV-2 Nucleocapsid Dimerization Domain bound to Fab-NP1E9 and Fab-NP3B4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9c2h__assembly_1__model_1

9c2h__assembly_1__model_1 | I(q)

9c2h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)