SAXSdb — 9ecf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Estrogen receptor beta

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Nuclear receptor coactivator 2 × 2 （Q15596） (3alpha,8alpha,17beta)-androst-5-ene-3,17-diol × 2 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Nuclear receptor coactivator 2 × 2 （Q15596） (3alpha,8alpha,17beta)-androst-5-ene-3,17-diol × 2 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Nuclear receptor coactivator 2 × 2 （Q15596） (3alpha,8alpha,17beta)-androst-5-ene-3,17-diol × 2 water × 4	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	Nuclear receptor coactivator 2 × 2 （Q15596） (3alpha,8alpha,17beta)-androst-5-ene-3,17-diol × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ESR2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 8–247； UniProt 261–500 Author chain B； PDBConstruct 8–247； UniProt 261–500 Author chain E； PDBConstruct 8–247； UniProt 261–500 Author chain F； PDBConstruct 8–247； UniProt 261–500 Author chain I； PDBConstruct 8–247； UniProt 261–500 Author chain J； PDBConstruct 8–247； UniProt 261–500 Author chain M； PDBConstruct 8–247； UniProt 261–500 Author chain N； PDBConstruct 8–247； UniProt 261–500

Nuclear receptor coactivator 2

OrganismNot specified

UniProt Q15596

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Estrogen receptor beta × 2 （Q92731） (3alpha,8alpha,17beta)-androst-5-ene-3,17-diol × 2 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Estrogen receptor beta × 2 （Q92731） (3alpha,8alpha,17beta)-androst-5-ene-3,17-diol × 2 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Estrogen receptor beta × 2 （Q92731） (3alpha,8alpha,17beta)-androst-5-ene-3,17-diol × 2 water × 4	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	Estrogen receptor beta × 2 （Q92731） (3alpha,8alpha,17beta)-androst-5-ene-3,17-diol × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCOA2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–13； UniProt 686–698 Author chain D； PDBConstruct 1–13； UniProt 686–698 Author chain G； PDBConstruct 1–13； UniProt 686–698 Author chain H； PDBConstruct 1–13； UniProt 686–698 Author chain K； PDBConstruct 1–13； UniProt 686–698 Author chain L； PDBConstruct 1–13； UniProt 686–698 Author chain O； PDBConstruct 1–13； UniProt 686–698 Author chain P； PDBConstruct 1–13； UniProt 686–698

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ecf
Deposition date deposition_date	2024-11-14
Last revision last_revision	2025-11-19
Structure title title	Crystal structure of the hERbeta LBD complexed with androstenediol and SRC 2-2 peptide (crystal form 2)
Keywords keywords	nuclear receptor, transcription factor, NUCLEAR PROTEIN; NUCLEAR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ecf__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ecf__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ecf__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.22 Å
Rg (electron density)	22.17 Å
Total Rg	22.97 Å
Atom count	3585
Residues	460
Excluded volume	65430 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ecf__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9ecf__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`9ecf__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`9ecf__assembly_4__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Estrogen receptor beta
Molecular weight formula_weight	28069.2 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,A,B,I,J,M,N
Atom count atom_count	14712

MHHHHHHDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Nuclear receptor coactivator 2
Molecular weight formula_weight	1579.9 kDa
Source method src_method	syn
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,C,D,K,L,O,P

KHKILHRLLQDSS

Entity 3 Entity 3 non-polymer

Description description	(3alpha,8alpha,17beta)-androst-5-ene-3,17-diol
Molecular weight formula_weight	290.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	632

▶

Unit-cell length a length_a	76.535 Å
Unit-cell length b length_b	108.381 Å
Unit-cell length c length_c	120.601 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	104.23 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	38.970 Å
R factor r_factor	0.2517
R_work r_work	0.2504
R_free r_free	0.2775

Crystal structure of the hERbeta LBD complexed with androstenediol and SRC 2-2 peptide (crystal form 2)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Estrogen receptor beta

State in the Current Structure

Other States of the Same Protein in the Database

Nuclear receptor coactivator 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ecf__assembly_4__model_1

9ecf__assembly_4__model_1 | I(q)

9ecf__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of the hERbeta LBD complexed with androstenediol and SRC 2-2 peptide (crystal form 2)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Estrogen receptor beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear receptor coactivator 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ecf__assembly_4__model_1

9ecf__assembly_4__model_1 | I(q)

9ecf__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)