SAXSdb — 9ef1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DILP1 B-chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Insulin-like receptor × 2 （P09208） 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INSL1_DROME
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain C； PDBConstruct 1–41； UniProt 30–70 Author chain D； PDBConstruct 1–27； UniProt 128–154

Insulin-like receptor

Drosophila melanogaster

UniProt P09208

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	DILP1 B-chain × 1 （Q9VT50） DILP1 A-chain × 1 （Q9VT50） 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INSR_DROME
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–2144； UniProt 1–2144 Author chain B； PDBConstruct 1–2144； UniProt 1–2144

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ef1
Deposition date deposition_date	2024-11-19
Structure title title	Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation
Keywords keywords	Insulin receptor, DILP, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ef1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ef1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ef1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.58 Å
Rg (electron density)	50.14 Å
Total Rg	50.17 Å
Atom count	22546
Residues	1418
Excluded volume	202610 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ef1__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	DILP1 B-chain
Molecular weight formula_weight	4243.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	22546

MVTPTGSGHQLLPPGNHKLCGPALSDAMDVVCPHGFNTLPK

Entity 2 Entity 2 polymer

Description description	DILP1 A-chain
Molecular weight formula_weight	3025.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

HLTGGVYDECCVKTCSYLELAIYCLPK

Entity 3 Entity 3 polymer

Description description	Insulin-like receptor
Molecular weight formula_weight	240078.1 kDa
EC 编号 ec_number	2.7.10.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MFNMPRGVTKSKSKRGKIKMENDMAAAATTTACTLGHICVLCRQEMLLDTCCCRQAVEAVDSPASSEEAYSSSNSSSCQASSEISAEEVWFLSHDDIVLCRRPKFDEVETTGKKRDVKCSGHQCSNECDDGSTKNNRQQRENFNIFSNCHNILRTLQSLLLLMFNCGIFNKRRRRQHQQQHHHHYQHHHQQHHQQHHQRQQANVSYTKFLLLLQTLAAATTRLSLSPKNYKQQQQLQHNQQLPRATPQQKQQEKDRHKCFHYKHNYSYSPGISLLLFILLANTLAIQAVVLPAHQQHLLHNDIADGLDKTALSVSGTQSRWTRSESNPTMRLSQNVKPCKSMDIRNMVSHFNQLENCTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLSKIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEILAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNNCIDEHTCCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQFDSRCVTANECITLTKFETNSVYSGIPYNGQCITHCPTGYQKSENKRMCEPCPGGKCDKECSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEISGDPPMDADKYALYVLDNRDLDELWGPNQTVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSDVGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKVEIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDRWKVSSPEKSGVMVLSNLIPYTNYSYYVRTMAISSELTNAESDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFIKAKLINRPTRNNNRDYCTEPLVKAMENDLPATTPTKKISDPLAGDCKCVEGSKKTSSQEYDDRKVQAGMEFENALQNFIFVPNIRKSKNGSSDKSDGAEGAALDSNAIPNGGATNPSRRRRDVALEPELDDVEGSVLLRHVRSITDDTDAFFEKDDENTYKDEEDLSSNKQFYEVFAKELPPNQTHFVFEKLRHFTRYAIFVVACREEIPSEKLRDTSFKKSLCSDYDTVFQTTKRKKFADIVMDLKVDLEHANNTESPVRVRWTPPVDPNGEIVTYEVAYKLQKPDQVEEKKCIPAADFNQTAGYLIKLNEGLYSFRVRANSIAGYGDFTEVEHIKVEPPPSYAKVFFWLLGIGLAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLAPLGQGSFGMVYEGILKSFPPNGVDRECAIKTVNENATDRERTNFLSEASVMKEFDTYHVVRLLGVCSRGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHSEAGLQHREKERKERNQLDAFAAVPLDQDLQDREQQEDATTPLRMGDYQQNSSLDQPPESPIAMVDDQGSHLPFSLPSGFIASSTPDGQTVMATAFQNIPAAQGDISATYVVPDADALDGDRGYEIYDPSPKCAELPTSRSGSTGGGKLSGEQHLLPRKGRQPTIMSSSMPDDVIGGSSLQPSTASAGSSNASSHTGRPSLKKTVADSVRNKANFINRHLFNHKRTGSNASHKSNASNAPSTSSNTNLTSHPVAMGNLGTIESGGSGSAGSYTGTPRFYTPSATPGGGSGMAISDNPNYRLLDESIASEQATILTTSSPNPNYEMMHPPTSLVSTNPNYMPMNETPVQMAGVTISHNPNYQPMQAPLNARQSQSSSDEDNEQEEDDEDEDDDVDDEHVEHIKMERMPLSRPRQRALPSKTQPPRSRSVSQTRKSPTNPNSGIGATGAGNRSNLLKENWLRPASTPRPPPPNGFIGREA

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Baculovirus expression vector pFastBac1-HM

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	12

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.400 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	4.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	23556

Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

DILP1 B-chain

State in the Current Structure

Other States of the Same Protein in the Database

Insulin-like receptor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ef1__assembly_1__model_1

9ef1__assembly_1__model_1 | I(q)

9ef1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)

Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

DILP1 B-chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Insulin-like receptor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ef1__assembly_1__model_1

9ef1__assembly_1__model_1 | I(q)

9ef1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

7. Citations (1)