SAXSdb — 9fp5

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein VP1

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 240 PDB declaration: 240-meric（240） Consistent with protein copy count	Chain A； UniProt 569–867 Chain B； UniProt 70–330 Chain C； UniProt 331–568 Chain D； UniProt 2–69	Not recorded	PLM PALMITIC ACID × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.2 cryo-EM vitrification conditions：Cryogen ETHANE；Sample was incubated for 15 s on the grid before blotted from the front for 1.5 s.	Resolution 2.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9FP5	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1D4M THE CRYSTAL STRUCTURE OF COXSACKIEVIRUS A9 TO 2.9 A RESOLUTION Deposited 1999-10-04	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-MERIC	Chain 1 568–866（299 aa） Fragment：VP1 Chain 2 69–329（261 aa） Fragment：VP2 Chain 3 330–567（238 aa） Fragment：VP3 Chain 4 1–68（68 aa） Fragment：VP4	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 120 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1D4M THE CRYSTAL STRUCTURE OF COXSACKIEVIRUS A9 TO 2.9 A RESOLUTION Deposited 1999-10-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 568–866（299 aa） Fragment：VP1 Chain 2 69–329（261 aa） Fragment：VP2 Chain 3 330–567（238 aa） Fragment：VP3 Chain 4 1–68（68 aa） Fragment：VP4	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 2 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1D4M THE CRYSTAL STRUCTURE OF COXSACKIEVIRUS A9 TO 2.9 A RESOLUTION Deposited 1999-10-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 20 PDB declaration: eicosameric	Chain 1 568–866（299 aa） Fragment：VP1 Chain 2 69–329（261 aa） Fragment：VP2 Chain 3 330–567（238 aa） Fragment：VP3 Chain 4 1–68（68 aa） Fragment：VP4	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 10 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1D4M THE CRYSTAL STRUCTURE OF COXSACKIEVIRUS A9 TO 2.9 A RESOLUTION Deposited 1999-10-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 24 PDB declaration: 24-meric	Chain 1 568–866（299 aa） Fragment：VP1 Chain 2 69–329（261 aa） Fragment：VP2 Chain 3 330–567（238 aa） Fragment：VP3 Chain 4 1–68（68 aa） Fragment：VP4	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 12 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1D4M THE CRYSTAL STRUCTURE OF COXSACKIEVIRUS A9 TO 2.9 A RESOLUTION Deposited 1999-10-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain 1 568–866（299 aa） Fragment：VP1 Chain 2 69–329（261 aa） Fragment：VP2 Chain 3 330–567（238 aa） Fragment：VP3 Chain 4 1–68（68 aa） Fragment：VP4	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 2 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1D4M THE CRYSTAL STRUCTURE OF COXSACKIEVIRUS A9 TO 2.9 A RESOLUTION Deposited 1999-10-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 120 PDB declaration: 120-meric	Chain 1 568–866（299 aa） Fragment：VP1 Chain 2 69–329（261 aa） Fragment：VP2 Chain 3 330–567（238 aa） Fragment：VP3 Chain 4 1–68（68 aa） Fragment：VP4	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60 MYR MYRISTIC ACID × 30	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
3J2J Empty coxsackievirus A9 capsid Deposited 2012-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain A 631–852（222 aa） Fragment：UNP residues 631-852 Chain B 331–568（238 aa） Fragment：UNP residues 331-568 Chain C 79–330（252 aa） Fragment：UNP residues 79-330	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions manual plunging；Cryogen ETHANE；manual plunging into liquid ethane (GATAN CRYOPLUNGE 3)	Resolution 9.54 Å
3J2J Empty coxsackievirus A9 capsid Deposited 2012-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 631–852（222 aa） Fragment：UNP residues 631-852 Chain B 331–568（238 aa） Fragment：UNP residues 331-568 Chain C 79–330（252 aa） Fragment：UNP residues 79-330	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions manual plunging；Cryogen ETHANE；manual plunging into liquid ethane (GATAN CRYOPLUNGE 3)	Resolution 9.54 Å
3J2J Empty coxsackievirus A9 capsid Deposited 2012-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain A 631–852（222 aa） Fragment：UNP residues 631-852 Chain B 331–568（238 aa） Fragment：UNP residues 331-568 Chain C 79–330（252 aa） Fragment：UNP residues 79-330	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions manual plunging；Cryogen ETHANE；manual plunging into liquid ethane (GATAN CRYOPLUNGE 3)	Resolution 9.54 Å
3J2J Empty coxsackievirus A9 capsid Deposited 2012-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 18 PDB declaration: octadecameric	Chain A 631–852（222 aa） Fragment：UNP residues 631-852 Chain B 331–568（238 aa） Fragment：UNP residues 331-568 Chain C 79–330（252 aa） Fragment：UNP residues 79-330	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions manual plunging；Cryogen ETHANE；manual plunging into liquid ethane (GATAN CRYOPLUNGE 3)	Resolution 9.54 Å
3J2J Empty coxsackievirus A9 capsid Deposited 2012-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 631–852（222 aa） Fragment：UNP residues 631-852 Chain B 331–568（238 aa） Fragment：UNP residues 331-568 Chain C 79–330（252 aa） Fragment：UNP residues 79-330	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM vitrification conditions manual plunging；Cryogen ETHANE；manual plunging into liquid ethane (GATAN CRYOPLUNGE 3)	Resolution 9.54 Å
8AT5 native Coxsackievirus A9 Deposited 2022-08-22	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain A 569–867（299 aa） Chain B 70–330（261 aa） Chain C 331–568（238 aa） Chain D 2–69（68 aa）	Not recorded	MYR MYRISTIC ACID × 60 PLM PALMITIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.25；PBS containing 2mM MgCl2, pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8AW6 Expanded Coxsackievirus A9 after 0.01% faf-BSA treatment Deposited 2022-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain A 569–867（299 aa） Chain B 70–330（261 aa） Chain C 331–568（238 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.25；DPBS containing 0.01% faf-BSA, pH 7.25, incubated at 37 C for 1 h cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8AXX Expanded Coxsackievirus A9 after treatment with endosomal ionic buffer Deposited 2022-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain A 569–867（299 aa） Chain B 70–330（261 aa） Chain C 331–568（238 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.25；endosomal ionic composition buffer, pH 7.25, incubated at 37 C for 3 h 20 mM NaCl, 6 mM KH2PO4, 12 mM K2HPO4, 0.5 mM MgCl2, 0.45 mM CaCl2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8S7J Coxsackievirus A9 bound with compound 20 (CL300) Deposited 2024-03-01	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain A 569–867（299 aa） Chain B 70–330（261 aa） Chain C 331–568（238 aa） Chain D 2–69（68 aa）	Not recorded	A1H9Q ~{N}-[(4-methoxyphenyl)methyl]-4-[(4-methylpiperazin-1-yl)methyl]aniline × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；PBS containing 2 mM MgCl2 and 5% DMSO. cryo-EM vitrification conditions Cryogen ETHANE；Sample was incubated for 15 s on the grid before blotted from the front for 1.5 s.	Resolution 2.26 Å
9EXI Coxsackievirus A9 bound with compound 14 (CL275) Deposited 2024-04-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain A 569–851（283 aa） Chain B 79–329（251 aa） Chain C 331–568（238 aa） Chain D 2–69（68 aa）	Not recorded	A1H8J 4-[(4-methylpiperazin-1-yl)methyl]-N-[[4-(trifluoromethyl)phenyl]methyl]aniline × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；PBS containing 2 mM MgCl2 and 5% DMSO. cryo-EM vitrification conditions Cryogen ETHANE；Sample was incubated for 15 s on the grid before blotted from the front for 1.5 s.	Resolution 2.31 Å
9FA9 Coxsackievirus A9 bound with compound 16 (CL298) Deposited 2024-05-10	Different construct Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain A 569–851（283 aa） Chain B 70–330（261 aa） Chain C 331–568（238 aa） Chain D 2–69（68 aa）	Not recorded	A1IBS ~{N}-[(2-fluorophenyl)methyl]-4-[(4-methylpiperazin-1-yl)methyl]aniline × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；Sample was incubated for 15 s on the grid before blotted from the front for 1.5 s.	Resolution 2.75 Å
9FCZ Coxsackievirus A9 bound with compound 17 (CL301) Deposited 2024-05-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain A 569–851（283 aa） Chain B 79–329（251 aa） Chain C 331–568（238 aa） Chain D 2–69（68 aa）	Not recorded	A1IB2 ~{N}-[(3-fluorophenyl)methyl]-4-[(4-methylpiperazin-1-yl)methyl]aniline × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；PBS containing 2 mM MgCl2 and 5% DMSO. cryo-EM vitrification conditions Cryogen ETHANE；Sample was incubated for 15 s on the grid before blotted from the front for 1.5 s.	Resolution 2.53 Å
9FGN Coxsackievirus A9 bound with compound 18 (CL304) Deposited 2024-05-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain A 569–850（282 aa） Chain B 79–328（250 aa） Chain C 332–567（236 aa） Chain D 2–68（67 aa）	Not recorded	A1ICH ~{N}-[[2,4-bis(fluoranyl)phenyl]methyl]-4-[(4-methylpiperazin-1-yl)methyl]aniline × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；PBS containing 2 mM MgCl2 and 5% DMSO. cryo-EM vitrification conditions Cryogen ETHANE；Sample was incubated for 15 s on the grid before blotted from the front for 1.5 s.	Resolution 2.64 Å
9FO2 Coxsackievirus A9 bound with compound 15 (CL278) Deposited 2024-06-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain A 569–867（299 aa） Chain B 79–329（251 aa） Chain C 331–568（238 aa） Chain D 2–69（68 aa）	Not recorded	A1IEI ~{N}-[(4-fluorophenyl)methyl]-4-[(4-methylpiperazin-1-yl)methyl]aniline × 60 MYR MYRISTIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；Sample was blotted from the front for 1.5 s.	Resolution 2.58 Å
9FO5 Coxsackievirus A9 bound with compound 19 (CL313) Deposited 2024-06-11	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 240 PDB declaration: 240-meric	Chain A 569–867（299 aa） Chain B 70–330（261 aa） Chain C 331–568（238 aa） Chain D 2–69（68 aa）	Not recorded	A1IEH ~{N}-[[3,4-bis(fluoranyl)phenyl]methyl]-4-[(4-methylpiperazin-1-yl)methyl]aniline × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；Sample was incubated for 15 s on the grid before blotted from the front for 1.5 s.	Resolution 2.69 Å

12 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLG_CXA9
Isoform	—
PDB entities	1, 2, 3, 4
Chains and sequence ranges	Author chain A； PDBConstruct 1–299； UniProt 569–867 Author chain B； PDBConstruct 1–261； UniProt 70–330 Author chain C； PDBConstruct 1–238； UniProt 331–568 Author chain D； PDBConstruct 1–68； UniProt 2–69

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9fp5
Deposition date deposition_date	2024-06-13
Structure title title	Coxsackievirus A9 bound with CL213.
Keywords keywords	Antiviral, capsid stabilizer, hydrophobic pocket, cryoEM, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	30.19 Å
Radius of gyration Rg (electron density) rg_electron	29.26 Å
Forward intensity I(0) i0	139301000.00
Molecular weight molecular_weight	92654.0 kDa
Excluded volume excluded_volume	115560 Å³
Envelope volume envelope_volume	148670 Å³
Hydration-shell volume shell_volume	41457 Å³
Envelope diameter envelope_diameter	102.0 Å
Shell Rg shell_rg	37.20 Å
Envelope Rg envelope_rg	29.76 Å
Shape Rg shape_rg	29.25 Å
Total Rg total_rg	30.03 Å
Total atoms total_atoms	12842
Residues n_residues	827
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	96.0 Å
Rg (real space) rg_real	30.11 Å
Rg uncertainty (real space) rg_real_error	0.67 Å
I(0) (real space) i0_real	1.3930e+08
I(0) uncertainty (real space) i0_real_error	2.1350e+06
Rg (reciprocal space) rg_reciprocal	30.15 Å
I(0) (reciprocal space) i0_reciprocal	139300000.0000
Solution quality estimate total_estimate	0.8924
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	35.1 Å
Skewness Skewness skewness	0.298
Kurtosis Kurtosis kurtosis	-0.339
Angular range angular_range	— – 0.2600 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	27650000.0000
Real-space data points n_real_points	53
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.906; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.879

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Capsid protein VP1
Molecular weight formula_weight	33869.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	12842

GDVEEAIERAVVHVADTMRSGPSNSASVPALTAVETGHTSQVTPSDTMQTRHVKNYHSRSESTVENFLGRSACVYMEEYKTTDNDVNKKFVAWPINTKQMVQMRRKLEMFTYLRFDMEVTFVITSRQDPGTTLAQDMPVLTHQIMYVPPGGPIPAKVDDYAWQTSTNPSIFWTEGNAPARMSIPFISIGNAYSNFYDGWSNFDQRGSYGYNTLNNLGHIYVRHVSGSSPHPITSTIRVYFKPKHTRAWVPRPPRLCQYKKAFSVDFTPTPITDTRKDINTVTTVAQSRRRGDMSTLNTH

Entity 2 Entity 2 polymer

Description description	Capsid protein VP2
Molecular weight formula_weight	28885.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

SPTVEECGYSDRVRSITLGNSTITTQECANVVVGYGRWPTYLRDDEATAEDQPTQPDVATCRFYTLDSIKWEKGSVGWWWKFPEALSDMGLFGQNMQYHYLGRAGYTIHVQCNASKFHQGCLLVVCVPEAEMGGAVVGQAFSATAMANGDKAYEFTSATQSDQTKVQTAIHNAGMGVGVGNLTIYPHQWINLRTNNSATIVMPYINSVPMDNMFRHYNFTLMVIPFVKLDYADTASTYVPITVTVAPMCAEYNGLRLAQAQ

Entity 3 Entity 3 polymer

Description description	Capsid protein VP3
Molecular weight formula_weight	26335.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GLPTMNTPGSTQFLTSDDFQSPCALPQFDVTPSMNIPGEVKNLMEIAEVDSVVPVNNVQDTTDQMEMFRIPVTINAPLQQQVFGLRLQPGLDSVFKHTLLGEILNYYAHWSGSMKLTFVFCGSAMATGKFLIAYSPPGANPPKTRKDAMLGTHIIWDIGLQSSCVLCVPWISQTHYRLVQQDEYTSAGYVTCWYQTGMIVPPGTPNSSSIMCFASACNDFSVRMLRDTPFISQDNKLQ

Entity 4 Entity 4 polymer

Description description	Capsid protein VP4
Molecular weight formula_weight	7352.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

GAQVSTQKTGAHETSLSAAGNSIIHYTNINYYKDAASNSANRQDFTQDPSKFTEPVKDVMIKSLPALN

Entity 5 Entity 5 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (2)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.50 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	90678

fit	/app/data/saxs_computation/fp/9fp5/9fp5.fit
pddf	/app/data/pr_computation/fp/9fp5/9fp5.pr.out
profile	/app/data/saxs_computation/fp/9fp5/9fp5.dat

Coxsackievirus A9 bound with CL213.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein VP1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)