SAXSdb — 9h2h

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein AC54

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 40 DNA 4	DNA (58-MER) × 2 DNA (58-MER) × 2 Occlusion-derived virus envelope protein E27 × 16 （P41702） Protein C42 × 16 （P25695）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AC54_NPVAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–365； UniProt 1–365 Author chain B； PDBConstruct 1–365； UniProt 1–365 Author chain C； PDBConstruct 1–365； UniProt 1–365 Author chain D； PDBConstruct 1–365； UniProt 1–365

Occlusion-derived virus envelope protein E27

OrganismNot specified

UniProt P41702

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 40 DNA 4	Protein AC54 × 8 （P41458） DNA (58-MER) × 2 DNA (58-MER) × 2 Protein C42 × 16 （P25695）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E27_NPVAC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–290； UniProt 1–290 Author chain H； PDBConstruct 1–290； UniProt 1–290 Author chain K； PDBConstruct 1–290； UniProt 1–290 Author chain L； PDBConstruct 1–290； UniProt 1–290 Author chain O； PDBConstruct 1–290； UniProt 1–290 Author chain P； PDBConstruct 1–290； UniProt 1–290 Author chain S； PDBConstruct 1–290； UniProt 1–290 Author chain T； PDBConstruct 1–290； UniProt 1–290

Protein C42

OrganismNot specified

UniProt P25695

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 40 DNA 4	Protein AC54 × 8 （P41458） DNA (58-MER) × 2 DNA (58-MER) × 2 Occlusion-derived virus envelope protein E27 × 16 （P41702）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C42_NPVAC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–361； UniProt 1–361 Author chain J； PDBConstruct 1–361； UniProt 1–361 Author chain M； PDBConstruct 1–361； UniProt 1–361 Author chain N； PDBConstruct 1–361； UniProt 1–361 Author chain Q； PDBConstruct 1–361； UniProt 1–361 Author chain R； PDBConstruct 1–361； UniProt 1–361 Author chain U； PDBConstruct 1–361； UniProt 1–361 Author chain V； PDBConstruct 1–361； UniProt 1–361

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9h2h
Deposition date deposition_date	2024-10-11
Last revision last_revision	2025-06-04
Structure title title	AcMNPV apical cap - composite map of the C2 plug
Keywords keywords	nucleocapsid, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9h2h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9h2h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9h2h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	74.62 Å
Rg (electron density)	74.83 Å
Total Rg	74.77 Å
Atom count	78196
Residues	9182
Excluded volume	1387200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9h2h__assembly_1__model_1`	44-meric （44）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Protein AC54
Molecular weight formula_weight	42151.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	39098

MCSTKKPIKLDLCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEARKTILNADSVYECMLIRPIRTEHFRSVDEAGEHNMSVLKIIIDAVIKYIGKLADDEYILIADRMYVDLIYSEFRAIILPQSAYIIKGDYAESDSESGQSVDVCNELEYPWKLITANNCIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFDVIAENTSISIIVRNLGSCPNNKDRVKCCDLNYGGVPPGHVMCPPREITKKFFHYAKWVRNPNKYKRYSELIARQSETGGGSASLRENVNNQLHARDVSQLHLLDWENFMGEFSSYFGLHAHNV

Entity 2 Entity 2 polymer

Description description	DNA (58-MER)
Molecular weight formula_weight	17953.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E

TATTCCAAACGTTAAAACCTTTAGGAGAAGTAAAACAAAAAAAAATTTAATTAAATGG

Entity 3 Entity 3 polymer

Description description	DNA (58-MER)
Molecular weight formula_weight	17778.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	F

CCATTTAATTAAATTTTTTTTTGTTTTACTTCTCCTAAAGGTTTTAACGTTTGGAATA

Entity 4 Entity 4 polymer

Description description	Occlusion-derived virus envelope protein E27
Molecular weight formula_weight	33568.2 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,K,L,O,P,S,T

MKRIKCNKVRTVTEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYMAMLSTLEMTQPLLEIFRNKADTRQIAAVVFSTLAFIHNRFHPLVTNFTNKMEFVVTETNDTSIPGEPILFTENEGVLLCSVDRPSIVKMLSREFDTEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNKQPNYDMDLSDFSITEVEATQYLTLLLTVEHAYLHYYIFKNYGVFEYCKSLTDHSLFTNKLRSTMSTKTSNLLLSKFKFTIEDFDKINSNSVTSGFNIYNFNK

Entity 5 Entity 5 polymer

Description description	Protein C42
Molecular weight formula_weight	41583.6 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,M,N,Q,R,U,V

MSAIALYLEINKLRLKIDEPMQLAIWPQLFPLLCDEHQSVQLNTDVLINFMMHVARKSQNTILNNNAAIASQYAAGNADVVAAPASAQPTPRPVINLFARANAAAPAQPSEELINMRRYRNAARKLIHHYSLNSTSSTEYKISDVVMTMIFLLRSEKYHSLFKLLETTFDDYTCRPQMTQVQTDTLLDAVRSLLEMPSTTIDLTTVDIMRSSFARCFNSPIMRYAKIVLLQNVALQRDKRTTLEELLIERGEKIQMLQPQQYINSGTEIPFCDDAEFLNRLLKHIDPYPLSRMYYNAANTMFYTTMENYAVSNCKFNIEDYNNIFKVMENIRKHSNKNSNDQDELNIYLGVQSSNAKRKKY

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	12477

AcMNPV apical cap - composite map of the C2 plug

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein AC54

State in the Current Structure

Other States of the Same Protein in the Database

Occlusion-derived virus envelope protein E27

State in the Current Structure

Other States of the Same Protein in the Database

Protein C42

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9h2h__assembly_1__model_1

9h2h__assembly_1__model_1 | I(q)

9h2h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)

AcMNPV apical cap - composite map of the C2 plug

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein AC54

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Occlusion-derived virus envelope protein E27

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein C42

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9h2h__assembly_1__model_1

9h2h__assembly_1__model_1 | I(q)

9h2h__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)