SAXSdb — 9lc0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

60 kDa protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	Gp64 × 6 （A0MZE6） Non-contractile tail sheath × 6 （A0MZE7） 30 kDa protein × 12 （A0MZE9） Gp54 × 12 （Q859Q3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 24	Gp64 × 2 （A0MZE6） Non-contractile tail sheath × 2 （A0MZE7） 30 kDa protein × 4 （A0MZE9） Gp54 × 4 （Q859Q3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 24	Gp64 × 2 （A0MZE6） Non-contractile tail sheath × 2 （A0MZE7） 30 kDa protein × 4 （A0MZE9） Gp54 × 4 （Q859Q3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0MZE8_BPN4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–556； UniProt 1–556 Author chain B； PDBConstruct 1–556； UniProt 1–556 Author chain C； PDBConstruct 1–556； UniProt 1–556 Author chain D； PDBConstruct 1–556； UniProt 1–556 Author chain E； PDBConstruct 1–556； UniProt 1–556 Author chain F； PDBConstruct 1–556； UniProt 1–556 Author chain G； PDBConstruct 1–556； UniProt 1–556 Author chain L； PDBConstruct 1–556； UniProt 1–556 Author chain Q； PDBConstruct 1–556； UniProt 1–556 Author chain V； PDBConstruct 1–556； UniProt 1–556 Author chain a； PDBConstruct 1–556； UniProt 1–556 Author chain f； PDBConstruct 1–556； UniProt 1–556

Gp64

OrganismNot specified

UniProt A0MZE6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	60 kDa protein × 36 （A0MZE8） Non-contractile tail sheath × 6 （A0MZE7） 30 kDa protein × 12 （A0MZE9） Gp54 × 12 （Q859Q3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 24	60 kDa protein × 12 （A0MZE8） Non-contractile tail sheath × 2 （A0MZE7） 30 kDa protein × 4 （A0MZE9） Gp54 × 4 （Q859Q3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 24	60 kDa protein × 12 （A0MZE8） Non-contractile tail sheath × 2 （A0MZE7） 30 kDa protein × 4 （A0MZE9） Gp54 × 4 （Q859Q3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0MZE6_BPN4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain M； PDBConstruct 1–417； UniProt 1–417 Author chain R； PDBConstruct 1–417； UniProt 1–417

Non-contractile tail sheath

OrganismNot specified

UniProt A0MZE7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	60 kDa protein × 36 （A0MZE8） Gp64 × 6 （A0MZE6） 30 kDa protein × 12 （A0MZE9） Gp54 × 12 （Q859Q3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 24	60 kDa protein × 12 （A0MZE8） Gp64 × 2 （A0MZE6） 30 kDa protein × 4 （A0MZE9） Gp54 × 4 （Q859Q3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 24	60 kDa protein × 12 （A0MZE8） Gp64 × 2 （A0MZE6） 30 kDa protein × 4 （A0MZE9） Gp54 × 4 （Q859Q3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCTSP_BPN4
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–1382； UniProt 1–1382 Author chain N； PDBConstruct 1–1382； UniProt 1–1382

30 kDa protein

OrganismNot specified

UniProt A0MZE9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	60 kDa protein × 36 （A0MZE8） Gp64 × 6 （A0MZE6） Non-contractile tail sheath × 6 （A0MZE7） Gp54 × 12 （Q859Q3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 24	60 kDa protein × 12 （A0MZE8） Gp64 × 2 （A0MZE6） Non-contractile tail sheath × 2 （A0MZE7） Gp54 × 4 （Q859Q3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 24	60 kDa protein × 12 （A0MZE8） Gp64 × 2 （A0MZE6） Non-contractile tail sheath × 2 （A0MZE7） Gp54 × 4 （Q859Q3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0MZE9_BPN4
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–236； UniProt 1–236 Author chain J； PDBConstruct 1–236； UniProt 1–236 Author chain O； PDBConstruct 1–236； UniProt 1–236 Author chain S； PDBConstruct 1–236； UniProt 1–236

Gp54

OrganismNot specified

UniProt Q859Q3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 72	60 kDa protein × 36 （A0MZE8） Gp64 × 6 （A0MZE6） Non-contractile tail sheath × 6 （A0MZE7） 30 kDa protein × 12 （A0MZE9）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 24	60 kDa protein × 12 （A0MZE8） Gp64 × 2 （A0MZE6） Non-contractile tail sheath × 2 （A0MZE7） 30 kDa protein × 4 （A0MZE9）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 24	60 kDa protein × 12 （A0MZE8） Gp64 × 2 （A0MZE6） Non-contractile tail sheath × 2 （A0MZE7） 30 kDa protein × 4 （A0MZE9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q859Q3_BPN4
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain K； PDBConstruct 1–299； UniProt 1–299 Author chain P； PDBConstruct 1–299； UniProt 1–299 Author chain T； PDBConstruct 1–299； UniProt 1–299 Author chain U； PDBConstruct 1–299； UniProt 1–299

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9lc0
Deposition date deposition_date	2025-01-03
Structure title title	tail complex of mature phage N4
Keywords keywords	Complex, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9lc0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9lc0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9lc0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	109.80 Å
Total Rg	109.80 Å
Atom count	155259
Residues	19611
Excluded volume	2759400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9lc0__assembly_1__model_1`	72-meric （72）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9lc0__assembly_2__model_1`	24-meric （24）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`9lc0__assembly_3__model_1`	24-meric （24）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	60 kDa protein
Molecular weight formula_weight	58943.9 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,L,Q,V,a,f
Atom count atom_count	51753

MSGHTPFNTIPNEGYCCETLNDPIVDKMIGNAYYVVKFVALRMPFIKNVSDNMTQLLAIHNKLTELSAIYTKLDELQLIHNNLDKLQELYNQLSKLTGLYDNLQALLRVYDNLTPINTVASNIDAVNTVATDIAKVIIVSAQIDKVITVANSITNVNTVAGSIDAVNTVSTNINAIKNVNTNMAALLDLDNHMTELLAVHARLGDLVTIAEQLDTIIADHEKYATAEGAGLIGFNQAQTYAANTVGAMLRQVITMGNDKGGYAVAGKLTSARGVWSLATGSINMNAPTAGAVANLVLNYKAGKVSGLLVAPSQQMALDGLIMGASTADNTATVSVTAPLRFKADLTAKTISGVNTRIMPSSAVTLNVDAYGGITLGYPPSLQTVEPVMTFITPTGKAPLTPRFSSVTAGAAVLVMVGEAEAQLKYSGGGWAAVSDWDSGTYCAFDTVSGELTVYHSTLIKDSTVTFSLLLPTDDTQLTAQLKSHTDSSFVVKIAKPDGSLLDAPLEGMGIMYSRGMHGIYKVPYGSLIVDVGRVQVKFSEFNTTEGISVVGINSNA

Entity 2 Entity 2 polymer

Description description	Gp64
Molecular weight formula_weight	48100.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,R

MSNAAVVPMPYSPTTVPREQIREIQLQLINEMTDVHMGALTAQYMPDDFTFEPGIGQIHFNVETSRKVCLDLAKSVLRLVPVYPLVSPVKKQHDDYWFVGRLGLDPVSEPEPINMPTMEFYKRFLSLLHERDMKFVNSVAYEILNFFMPDEWKQLNWKGDPALSGWYPPSSFIQPTNKDALDFVSKAQCQILKECQNLGMELYFQIGEPWWWDGSYNTGEGKNAPCIYDPKTMALYKEETGNDVPTPWIKDIFAPVEEHQWPYVDWLCTKLGQSTNYIRDYVKGKFPDAQATLLFFTPQIMSPASELTGRLNFPESEWIFPNYDFVQIEDYDWIIDGRLDLVPLTFDAAVNRLGYPLNVVHYFIGFVLLPEDAKKIWADVDKAWGLALEAGIPHIYPWSYTQVMRDGVIYAVPKVCG

Entity 3 Entity 3 polymer

Description description	Non-contractile tail sheath
Molecular weight formula_weight	154255.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,N

MSIEDYLKGKNCLASPNYDPDDQHSSWREDLPQFKKDREHLTLVNTRRNRTYNTKLNRFDPEYWVVDYNALMVATIIPYGSKSFKVPCQWRTNKDFLGVRWMTEDTFDHHLYRYETDPNYLGLILAFRHNPDEPDKFTVTIQTPEKAYTYRLAPYGFNNKTRRWECLDTKYGTKRTYQADIFVATDEDIPESEMTEVYGTKDYIFILDFADLRTGVAFNGVTINPRNITMISFDCTEAHHGLGKDAYIAAMYNNDDGATFQMEIGGIHTNAALAAGDKLQCIWRYLDVNGNAQAAENEFEVVSYEGFGTSNFSVKCKGMLPGKFIGCDAFYGKYLQTDGPIKQVDSVKWFTNLTVSGSGRKQLGQRKYPQVVMGMGMTSGFDDGYNLTPERQVKMAYGLGYRDWWTTYIGMSHYWKGLTAFQDKETGELITEQTVLDYPILFAGESQVAIHFMSGAYPDRGYDVFQKYMTETWGINYAGVHPINGTTGSTAVDRACAVNPNSEVFDPTQSSGAGGLWWWDLEADKPGPALLHCVGQVGKLKPKAIIWGQGDQDATALAYPGDRNPAPSLTRTKQATKKVFEYLRSLYGQIPIFIQELSYAWGITNTDAPNVPIRTGLPSFLAARRNTWGDIEFRWKSYGLDPALAQYRIEIYNPSNLNQILHSFVVSGTQEANGYVYADFTVEDWIPVMMEAVGSPNPWEFMKWRVVCLYQEREIPSAPWSDNIPLDNAGLVKKTILVGINQFGGGHFTDMSDPTATTANGAIGRKDKVSASTLRLTFAEKAGLRPIQVMPVNVAADSAGMTVGTHKWWNTSSNSPGDALLAINDMVKGLGVKPDYFIEANPWETMYMKDVNSSTWPALMTAFESSNKAMLAWMRTNWGNPNLEIWFQGATTVWFGVAPPNDLNSEATVTVRDKQIQMATANIGFKLGSFVPGSNLYTAYRNVESSWIYYTVEAFHATAIELGEALALNINRATNPPDWSYLRPPANLQGRKLATRDIKMTWDNRAGITHWKYANRHVTTGAEISSGILTSPEYVFTLNDQQNAYNGDTLNMSFSVSEYAADSGAVGASSSFVGVVQNGSYMQTPTQLKAAKQLNGDIIFTWVGRPSWQHFWVVNTSVNDSKTVIFSKEWSSESLTWTVAEQNEFYGLEEGGATHVIFMVSEYDPSNGLVSIGAQVTGQAEQPSNPMNPVAGLYAVFTGDPGNSNIKIMWDKPSVGGRDVRIRNMHVTSSATISDQFVSDNNLVFTREEQVAAYGFTASSVSVRAQEHDIESGALGLTTEYVAVPETAGTVGQGFAKKDSVGNCTMSWEVGDAVQWQVEILNAENSTVVKTEIVVAPTITWMAEEITAEYGYLTDHMVWRVRPYRADGASNVAKQFDMTATL

Entity 4 Entity 4 polymer

Description description	30 kDa protein
Molecular weight formula_weight	27192.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,O,S,H

MYYIEELFCRLANGVLNNTGIVTDDRGDIEDDSKPFIIVAANEALTRLHGRFNMRNNNVVVEMQEGRTNYPLLAKYAVQSYDPNEVKCPFIMDLAGEKFAEDVIRILEVYDDKGRRRPLNDRNNPCSLFTPRPNVLQNNAPKAWEVLNVMYQAKHPKLSTAEDGYNEIDIPDTLDPALDAYIAYRYYTSLNTPESSAKAAEYLSFYDSICREVVEYDLTSDTEVDTNTLFRKRGWR

Entity 5 Entity 5 polymer

Description description	Gp54
Molecular weight formula_weight	32438.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,P,T,U

MSCGAELEANALLTALVAGEDFTLPDIDMSGSEYDIPGGINSPIYAEIEKITTEQLTTREVGGSGVFDALMQSASNHLLAEFKNNRITGGDYVKAYIATMEACMANAVQFLTTKDQAYWNAVTAQVAAITARANLGIIKANFVTAKIQALATKAEYALTKLKLSNESVTYCTAQYNLSSMLPQQLLMLKNQTTQVAEQTKLTTEQINMTKEQKEAQRAQTSDTRTDGTRVAGSVGKQKELYDQQITSYKRDAEVKAAKLFTDAWVTQKTIDEGLSPPNGFTNSSLDSILTALKNNNALG

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	47179

tail complex of mature phage N4

1. Protein Identity and Related Structures Protein Identity & Related Structures

60 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Gp64

State in the Current Structure

Other States of the Same Protein in the Database

Non-contractile tail sheath

State in the Current Structure

Other States of the Same Protein in the Database

30 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Gp54

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9lc0__assembly_1__model_1

9lc0__assembly_1__model_1 | I(q)

9lc0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)

tail complex of mature phage N4

1. Protein Identity and Related Structures Protein Identity & Related Structures

60 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Gp64

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Non-contractile tail sheath

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Gp54

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9lc0__assembly_1__model_1

9lc0__assembly_1__model_1 | I(q)

9lc0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)