9od3

SIPV3-6B5 Complex

Method: ELECTRON MICROSCOPY D_max: 113.3 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP1

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain 1； UniProt 579–878 Chain 2； UniProt 70–340 Chain 3； UniProt 341–578 Chain 4； UniProt 2–69	Not recorded	6B5 Heavy Chain × 1 6B5 Light Chain × 1 PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.94 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9OD3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PVC REFINEMENT OF THE SABIN STRAIN OF TYPE 3 POLIOVIRUS AT 2.4 ANGSTROMS AND THE CRYSTAL STRUCTURES OF ITS VARIANTS AT 2.9 ANGSTROMS RESOLUTION Deposited 1995-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-MERIC	Chain 2 70–340（271 aa） Chain 4 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1PVC REFINEMENT OF THE SABIN STRAIN OF TYPE 3 POLIOVIRUS AT 2.4 ANGSTROMS AND THE CRYSTAL STRUCTURES OF ITS VARIANTS AT 2.9 ANGSTROMS RESOLUTION Deposited 1995-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 70–340（271 aa） Chain 4 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1PVC REFINEMENT OF THE SABIN STRAIN OF TYPE 3 POLIOVIRUS AT 2.4 ANGSTROMS AND THE CRYSTAL STRUCTURES OF ITS VARIANTS AT 2.9 ANGSTROMS RESOLUTION Deposited 1995-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 2 70–340（271 aa） Chain 4 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1PVC REFINEMENT OF THE SABIN STRAIN OF TYPE 3 POLIOVIRUS AT 2.4 ANGSTROMS AND THE CRYSTAL STRUCTURES OF ITS VARIANTS AT 2.9 ANGSTROMS RESOLUTION Deposited 1995-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 2 70–340（271 aa） Chain 4 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1PVC REFINEMENT OF THE SABIN STRAIN OF TYPE 3 POLIOVIRUS AT 2.4 ANGSTROMS AND THE CRYSTAL STRUCTURES OF ITS VARIANTS AT 2.9 ANGSTROMS RESOLUTION Deposited 1995-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 70–340（271 aa） Chain 4 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1PVC REFINEMENT OF THE SABIN STRAIN OF TYPE 3 POLIOVIRUS AT 2.4 ANGSTROMS AND THE CRYSTAL STRUCTURES OF ITS VARIANTS AT 2.9 ANGSTROMS RESOLUTION Deposited 1995-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 2 70–340（271 aa） Chain 4 2–69（68 aa）	Not recorded	SPH SPHINGOSINE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.40 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å

11 other PDB entries and 61 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLG_POL3L
Isoform	—
PDB entities	1, 2, 3, 4
Chains and sequence ranges	Author chain 1； PDBConstruct 1–300； UniProt 579–878 Author chain 2； PDBConstruct 1–271； UniProt 70–340 Author chain 3； PDBConstruct 1–238； UniProt 341–578 Author chain 4； PDBConstruct 1–68； UniProt 2–69

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9od3
Deposition date deposition_date	2025-04-25
Structure title title	SIPV3-6B5 Complex
Keywords keywords	Virus, Antibody, Complex; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	34.30 Å
Radius of gyration Rg (electron density) rg_electron	33.55 Å
Forward intensity I(0) i0	222666000.00
Molecular weight molecular_weight	118630.0 kDa
Excluded volume excluded_volume	147890 Å³
Envelope volume envelope_volume	198430 Å³
Hydration-shell volume shell_volume	48823 Å³
Envelope diameter envelope_diameter	120.9 Å
Shell Rg shell_rg	40.62 Å
Envelope Rg envelope_rg	33.71 Å
Shape Rg shape_rg	33.51 Å
Total Rg total_rg	34.20 Å
Total atoms total_atoms	16446
Residues n_residues	1072
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	113.3 Å
Rg (real space) rg_real	34.25 Å
Rg uncertainty (real space) rg_real_error	0.76 Å
I(0) (real space) i0_real	2.2270e+08
I(0) uncertainty (real space) i0_real_error	3.2180e+06
Rg (reciprocal space) rg_reciprocal	34.29 Å
I(0) (reciprocal space) i0_reciprocal	222700000.0000
Solution quality estimate total_estimate	0.6893
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	39.4 Å
Skewness Skewness skewness	0.294
Kurtosis Kurtosis kurtosis	-0.377
Angular range angular_range	— – 0.2300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	50690000.0000
Real-space data points n_real_points	47
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.881; Stabil: 1.000; Sysdev: 0.122; Positv: 1.000; Valcen: 1.000; Smooth: 0.946

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	VP1
Molecular weight formula_weight	33523.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	16446

GIEDLISEVAQGALTLSLPKQQDSLPDTKASGPAHSKEVPALTAVETGATNPLAPSDTVQTRHVVQRRSRSESTIESFFARGACVAIIEVDNEQPTTRAQKLFAMWRITYKDTVQLRRKLEFFTYSRFDMEFTFVVTANFTNANNGHALNQVYQIMYIPPGAPTPKSWDDYTWQTSSNPSIFYTYGAAPARISVPYVGLANAYSHFYDGFAKVPLKTDANDQIGDSLYSAMTVDDFGVLAVRVVNDHNPTKVTSKVRIYMKPKHVRVWCPRPPRAVPYYGPGVDYRNNLDPLSEKGLTTY

Entity 2 Entity 2 polymer

Description description	VP2
Molecular weight formula_weight	30169.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SPNVEACGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEFIRDDEANPVDQPTEPDVATCRFYTLDTVMWGKESKGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYCLAGDSDKQRYTSYANANPGERGGKFYSQFNKDNAVTSPKREFCPVDYLLGCGVLLGNAFVYPHQIINLRTNNSATIVLPYVNALAIDSMVKHNNWGIAILPLSPLDFAQDSSVEIPITVTIAPMCSEFNGLRNVTAPKFQ

Entity 3 Entity 3 polymer

Description description	VP3
Molecular weight formula_weight	26289.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GLPVLNTPGSNQYLTSDNHQSPCAIPEFDVTPPIDIPGEVKNMMELAEIDTMIPLNLESTKRNTMDMYRVTLSDSADLSQPILCLSLSPAFDPRLSHTMLGEVLNYYTHWAGSLKFTFLFCGSMMATGKILVAYAPPGAQPPTSRKEAMLGTHVIWDLGLQSSCTMVVPWISNVTYRQTTQDSFTEGGYISMFYQTRIVVPLSTPKSMSMLGFVSACNDFSVRLLRDTTHISQSALPQ

Entity 4 Entity 4 polymer

Description description	VP4
Molecular weight formula_weight	7320.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAQVSSQKVGAHENSNRAYGGSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN

Entity 5 Entity 5 polymer

Description description	6B5 Heavy Chain
Molecular weight formula_weight	14395.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

EVQLVESGGGLVQPGRSLRLSCEASGFNFDDYAMHWVRQAPGKGLEWVSGISWSSSSRDYADSVKGRFTISRDNAKNSLYLHMNSLREEDTALYYCAKDMSYYGSGGVLHYYYYGMDVWGQGTTVTVSS

Entity 6 Entity 6 polymer

Description description	6B5 Light Chain
Molecular weight formula_weight	11397.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

SALTQPASVSGSPGQSITISCTGTSSDVGGYDYVSWYQQHPGKAPKVMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEAEYYCTSYTRSSTLVFGTGTKVTVL

Entity 7 Entity 7 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.940 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.94 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	459882

fit	/app/data/saxs_computation/od/9od3/9od3.fit
pddf	/app/data/pr_computation/od/9od3/9od3.pr.out
profile	/app/data/saxs_computation/od/9od3/9od3.dat

SIPV3-6B5 Complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)