← Back to search

9q0p

Human anti-EBV gH/gL Fab (AMMO1) with G111T light chain mutation

Method: X-RAY DIFFRACTION D_max: 81.7 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9q0p
deposition_date	2025-08-13
last_revision	2025-12-03
title	Human anti-EBV gH/gL Fab (AMMO1) with G111T light chain mutation
keywords	EBV, antibody, Fab, lambda, IMMUNE SYSTEM; IMMUNE SYSTEM
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	25.19 Å
rg_electron	24.20 Å
i0	37450800.00
molecular_weight	46649.0 kDa
excluded_volume	58011 Å³
envelope_volume	71057 Å³
shell_volume	24724 Å³
envelope_diameter	83.3 Å
shell_rg	31.01 Å
envelope_rg	24.05 Å
shape_rg	24.18 Å
total_rg	25.00 Å
total_atoms	3286
n_residues	437
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	81.7 Å
rg_real	25.17 Å
rg_real_error	0.58 Å
i0_real	3.7450e+07
i0_real_error	5.0490e+05
rg_reciprocal	25.18 Å
i0_reciprocal	37450000.0000
total_estimate	0.9023
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	28.5 Å
skewness	0.292
kurtosis	-0.460
angular_range	— – 0.3150 Å⁻¹
current_alpha	0.0000
highest_alpha	5495000.0000
n_real_points	64
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.923; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.973; Smooth: 0.984

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	IgG heavy chain
formula_weight	24116.0 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	3685

EVQLVQSGADVKKPGASVKVSCKASGYTFIHFGISWVRQAPGQGLEWMGWIDTNNGNTNYAQSLQGRVTMTTDTSTGTAYMELRSLSTDDTAVYFCARALEMGHRSGFPFDYWGQGVLVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Cricetulus griseus

Entity 2 polymer

description	IgG lambda light chain
formula_weight	23139.6 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

SYELTQPPSVSVAPGQRATITCGGHNIGAKNVHWYQQKPGQAPVLVIQYDSDRPSGIPERFSGSNSGSTATLTISRVEAGDEADYYCQVWDSGRGHPLYVFGGGTKVTVLTQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Cricetulus griseus

Entity 3 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	358

▶

6. Citations (1)

▶

length_a	50.722 Å
length_b	69.774 Å
length_c	124.659 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	2.080 Å
resolution_low	39.340 Å
r_factor	0.1933
r_work	0.1894
r_free	0.2427

fit	/app/data/saxs_computation/q0/9q0p/9q0p.fit
pddf	/app/data/pr_computation/q0/9q0p/9q0p.pr.out
profile	/app/data/saxs_computation/q0/9q0p/9q0p.dat

Human anti-EBV gH/gL Fab (AMMO1) with G111T light chain mutation

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (4)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

Entity 4 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)