← Back to search

9qmw

Arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase in complex with Sulcotrione (Mn)

Method: X-RAY DIFFRACTION D_max: 72.1 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qmw
deposition_date	2025-03-24
last_revision	2026-04-08
title	Arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase in complex with Sulcotrione (Mn)
keywords	;Dioxygenase, Phenylalanine catabolism, Tyrosine catabolism, Iron, Metal-binding, 4-hydroxyphenylpyruvate, homogentisic acid, OXIDOREDUCTASE ;; OXIDOREDUCTASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.82 Å
rg_electron	20.59 Å
i0	29853000.00
molecular_weight	41938.0 kDa
excluded_volume	52457 Å³
envelope_volume	60787 Å³
shell_volume	24192 Å³
envelope_diameter	73.5 Å
shell_rg	27.87 Å
envelope_rg	20.95 Å
shape_rg	20.58 Å
total_rg	21.55 Å
total_atoms	2952
n_residues	377
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	72.1 Å
rg_real	21.71 Å
rg_real_error	0.39 Å
i0_real	2.9850e+07
i0_real_error	3.8510e+05
rg_reciprocal	21.73 Å
i0_reciprocal	29850000.0000
total_estimate	0.8753
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	29.1 Å
skewness	0.234
kurtosis	-0.230
angular_range	— – 0.3650 Å⁻¹
current_alpha	0.0000
highest_alpha	6285000.0000
n_real_points	68
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.799; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.978

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	4-hydroxyphenylpyruvate dioxygenase
formula_weight	45343.0 kDa
ec_number	1.13.11.27
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	3269

GGSVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLLQIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTLEAK

Source

organism	Arabidopsis thaliana
common_name	thale cress
ncbi_taxonomy_id	3702
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	MANGANESE (II) ION
formula_weight	54.9 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	2-[2-chloro-4-(methylsulfonyl)benzoyl]cyclohexane-1,3-dione
formula_weight	328.8 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	261

▶

6. Citations (1)

▶

length_a	76.629 Å
length_b	83.888 Å
length_c	61.643 Å
angle_alpha	90.00 °
angle_beta	100.10 °
angle_gamma	90.00 °
z_pdb	4

space_group	C 1 2 1
int_tables_number	5
crystal_system	—

resolution	1.600 Å
resolution_low	41.940 Å
r_factor	0.1606
r_work	0.1594
r_free	0.1834

fit	/app/data/saxs_computation/qm/9qmw/9qmw.fit
pddf	/app/data/pr_computation/qm/9qmw/9qmw.pr.out
profile	/app/data/saxs_computation/qm/9qmw/9qmw.dat

Arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase in complex with Sulcotrione (Mn)

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction