← Back to search

9qou

;APH(2'')-IVa with an inhibitor ;

Method: X-RAY DIFFRACTION D_max: 109.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qou
deposition_date	2025-03-26
last_revision	2026-02-11
title	;APH(2'')-IVa with an inhibitor ;
keywords	inhibitor, complex, enzyme, ANTIBIOTIC; ANTIBIOTIC
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	33.19 Å
rg_electron	33.35 Å
i0	142379000.00
molecular_weight	65091.0 kDa
excluded_volume	63836 Å³
envelope_volume	116410 Å³
shell_volume	31261 Å³
envelope_diameter	116.7 Å
shell_rg	37.36 Å
envelope_rg	32.80 Å
shape_rg	33.39 Å
total_rg	33.52 Å
total_atoms	4992
n_residues	594
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	109.9 Å
rg_real	33.55 Å
rg_real_error	1.04 Å
i0_real	1.4240e+08
i0_real_error	2.4070e+06
rg_reciprocal	33.40 Å
i0_reciprocal	142400000.0000
total_estimate	0.8313
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	32.1 Å
skewness	0.487
kurtosis	-0.488
angular_range	— – 0.2400 Å⁻¹
current_alpha	0.0000
highest_alpha	10320000.0000
n_real_points	49
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.797; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.765; Smooth: 0.647

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	APH(2'')-Id
formula_weight	37596.8 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	B,A
atom_count	5036

MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK

Source

organism	Enterococcus casseliflavus
ncbi_taxonomy_id	37734
host_organism	Escherichia coli

Entity 2 non-polymer

description	5-chloranyl-4-[1-(phenylmethyl)-1,2,3-triazol-4-yl]-1~{H}-pyrrolo[2,3-b]pyridine
formula_weight	309.8 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	DIMETHYL SULFOXIDE
formula_weight	78.1 kDa
src_method	syn
entity_count	7

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	44

▶

6. Citations (1)

▶

length_a	75.795 Å
length_b	64.831 Å
length_c	77.561 Å
angle_alpha	90.00 °
angle_beta	91.70 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 1 21 1
int_tables_number	4
crystal_system	—

resolution	2.550 Å
resolution_low	38.760 Å
r_factor	0.2012
r_work	0.1981
r_free	0.2554

fit	/app/data/saxs_computation/qo/9qou/9qou.fit
pddf	/app/data/pr_computation/qo/9qou/9qou.pr.out
profile	/app/data/saxs_computation/qo/9qou/9qou.dat

;APH(2'')-IVa with an inhibitor ;

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction