SAXSdb — 9qtp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tetrahydromethanopterin S-methyltransferase subunit B

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Tetrahydromethanopterin S-methyltransferase subunit F × 1 （P80654） Tetrahydromethanopterin S-methyltransferase subunit H × 2 （P80650）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTRB_METMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–108； UniProt 1–108

Tetrahydromethanopterin S-methyltransferase subunit F

OrganismNot specified

UniProt P80654

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Tetrahydromethanopterin S-methyltransferase subunit B × 1 （P80655） Tetrahydromethanopterin S-methyltransferase subunit H × 2 （P80650）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTRF_METMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain P； PDBConstruct 1–72； UniProt 1–72

Tetrahydromethanopterin S-methyltransferase subunit H

OrganismNot specified

UniProt P80650

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Tetrahydromethanopterin S-methyltransferase subunit B × 1 （P80655） Tetrahydromethanopterin S-methyltransferase subunit F × 1 （P80654）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTRH_METMA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain o； PDBConstruct 1–316； UniProt 1–316 Author chain p； PDBConstruct 1–316； UniProt 1–316

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9qtp
Deposition date deposition_date	2025-04-09
Structure title title	Structure of the energy converting methyltransferase (Mtr) of Methanosarcina mazei in complex with a novel protein binder
Keywords keywords	;Sodium-pumping, membrane-bound, methyltransferase complex, methanogen, methanogenic, methylotrophic, archaeon, archaea, methanosarcina, methanosarcina mazei, Vitamin B12, corrinoid, cobalt, 5-hydroxybenzimidazole, small protein, oxygen-sensitive, MEMBRANE PROTEIN ;; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9qtp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9qtp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9qtp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.97 Å
Rg (electron density)	25.81 Å
Total Rg	26.62 Å
Atom count	5082
Residues	670
Excluded volume	91021 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9qtp__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Tetrahydromethanopterin S-methyltransferase subunit B
Molecular weight formula_weight	11879.6 kDa
EC 编号 ec_number	7.2.1.4
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E
Atom count atom_count	5082

MSIVRIAPEINLVMDTESGTVTQERKDSIQYSMEPVFERVDKLDAIADDLVNSLSPSKPLLNTWPGRENTSYIAGIYSNSFYGIIVGLAFSGLLALIIYITRLMGGVV

Entity 2 Entity 2 polymer

Description description	Tetrahydromethanopterin S-methyltransferase subunit F
Molecular weight formula_weight	7574.0 kDa
EC 编号 ec_number	7.2.1.4
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAEEHEKGVPMVLAPQMGAIDATVESIRYRAQLIARNQKLDSGVAATGIIGFAAGFLFSLLMVIVLPVAVGL

Entity 3 Entity 3 polymer

Description description	Tetrahydromethanopterin S-methyltransferase subunit H
Molecular weight formula_weight	34075.7 kDa
EC 编号 ec_number	7.2.1.4
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o,p

MFKFDKKQEVFELGGVKFGGQPGENPTVLVSTMFYARHKIVTDEDKGIFDRAAAETLWNTQVSLSDATGLPYVNQIVGETPESIKRYIEWFVGIDDRTPFLIDSSAGNVRAAAAQYCTEIGVADRAIHNSINASIEQSEIDVLTESDVSAAIVLAFNATDPTVKGKIDILEVGGSGQTKGMLQVAKECGIKYPIIDVAAMPLGAGSGATIRSVPTLKGKFGLPIGGGYHNMASAWDWLRKFKKTQPDPKAIYMPTDIGTNLVAQIAGSDYLLYGPIENVNQIFPAVAMVDIMLGETAKELGVEIADLENHPVTKLT

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	136531

Structure of the energy converting methyltransferase (Mtr) of Methanosarcina mazei in complex with a novel protein binder

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tetrahydromethanopterin S-methyltransferase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Tetrahydromethanopterin S-methyltransferase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Tetrahydromethanopterin S-methyltransferase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9qtp__assembly_1__model_1

9qtp__assembly_1__model_1 | I(q)

9qtp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

Structure of the energy converting methyltransferase (Mtr) of Methanosarcina mazei in complex with a novel protein binder

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tetrahydromethanopterin S-methyltransferase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tetrahydromethanopterin S-methyltransferase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tetrahydromethanopterin S-methyltransferase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9qtp__assembly_1__model_1

9qtp__assembly_1__model_1 | I(q)

9qtp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)