← Back to search

9r6e

Structural characterization of a N-Acetyl-D-glucosamine-binding site in human RNase2

Method: X-RAY DIFFRACTION D_max: 50.9 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9r6e
deposition_date	2025-05-12
last_revision	2026-04-22
title	Structural characterization of a N-Acetyl-D-glucosamine-binding site in human RNase2
keywords	Monosaccharide, RNase2, Immune system, PROTEIN BINDING; PROTEIN BINDING
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	16.12 Å
rg_electron	15.04 Å
i0	5656500.00
molecular_weight	16408.0 kDa
excluded_volume	20163 Å³
envelope_volume	22502 Å³
shell_volume	12857 Å³
envelope_diameter	50.5 Å
shell_rg	20.57 Å
envelope_rg	15.28 Å
shape_rg	15.02 Å
total_rg	16.09 Å
total_atoms	2238
n_residues	135
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	50.9 Å
rg_real	16.04 Å
rg_real_error	0.21 Å
i0_real	5.6570e+06
i0_real_error	5.4300e+04
rg_reciprocal	16.05 Å
i0_reciprocal	5657000.0000
total_estimate	0.9077
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	19.9 Å
skewness	0.166
kurtosis	-0.511
angular_range	— – 0.4950 Å⁻¹
current_alpha	0.0000
highest_alpha	1147000.0000
n_real_points	80
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.935; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.992

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (8)

Entity 1 polymer

description	Non-secretory ribonuclease
formula_weight	15611.8 kDa
ec_number	4.6.1.18
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2549

MKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Source

organism	;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ;
ncbi_taxonomy_id	866768
host_organism	Expression vector pET-mod

Entity 2 non-polymer

description	ACETATE ION
formula_weight	59.0 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	TETRAETHYLENE GLYCOL
formula_weight	194.2 kDa
src_method	syn
entity_count	1

Entity 5 non-polymer

description	FORMIC ACID
formula_weight	46.0 kDa
src_method	syn
entity_count	2

Entity 6 non-polymer

description	DI(HYDROXYETHYL)ETHER
formula_weight	106.1 kDa
src_method	syn
entity_count	1

Entity 7 non-polymer

description	SODIUM ION
formula_weight	23.0 kDa
src_method	syn
entity_count	4

Entity 8 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	200

▶

6. Citations (1)

▶

length_a	41.829 Å
length_b	52.621 Å
length_c	56.506 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	orthorhombic

resolution	1.020 Å
resolution_low	38.510 Å
r_factor	0.1268
r_work	0.1264
r_free	0.1365

fit	/app/data/saxs_computation/r6/9r6e/9r6e.fit
pddf	/app/data/pr_computation/r6/9r6e/9r6e.pr.out
profile	/app/data/saxs_computation/r6/9r6e/9r6e.dat