← Back to search

9r9h

;Cryo-EM structure of an extracellular contractile injection system in Salmonella enterica subspecies salamae, the sheath and inner tube module in extended state. ;

Method: ELECTRON MICROSCOPY D_max: 232.2 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9r9h
deposition_date	2025-05-20
title	;Cryo-EM structure of an extracellular contractile injection system in Salmonella enterica subspecies salamae, the sheath and inner tube module in extended state. ;
keywords	Contractile injection system, Salmonella enterica subspecies salamae, CONTRACTILE PROTEIN; CONTRACTILE PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	72.63 Å
rg_electron	71.83 Å
i0	23731200000.00
molecular_weight	1322800.0 kDa
excluded_volume	1658300 Å³
envelope_volume	2507700 Å³
shell_volume	265960 Å³
envelope_diameter	240.2 Å
shell_rg	87.03 Å
envelope_rg	70.48 Å
shape_rg	71.81 Å
total_rg	72.05 Å
total_atoms	184968
n_residues	12006
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	232.2 Å
rg_real	72.25 Å
rg_real_error	1.33 Å
i0_real	2.3730e+10
i0_real_error	4.7190e+08
rg_reciprocal	73.81 Å
i0_reciprocal	23800000000.0000
total_estimate	0.8059
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	95.0 Å
skewness	0.056
kurtosis	-0.530
angular_range	— – 0.1100 Å⁻¹
current_alpha	0.0007
highest_alpha	11040000000.0000
n_real_points	23
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.850; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.922; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (2)

Entity 1 polymer

description	Phage tail sheath family protein
formula_weight	57351.9 kDa
src_method	man
entity_count	18

Polymer

type	polypeptide(L)
strand_id	T,U,V,W,X,Y,Z,a,b,c,d,e,f,g,h,i,j,k
atom_count	184968

MGVMKTPGVYIVEQNAFPNSVVEVATAVPAFIGYTEKADNGGKSLSNKGWRITSMSEYRQYFGGEPQHLFEISEISTTSNANIREAFKQSGKTYQITQSNTRHHLYYSMLFFFQNGGGPCYIVSVGNYSDDIDAAVLKGGILPLIKEAEPTMLLIPEAIQLAEDDCINVEQAMLGHCGGKMKNRVAILDVWNGYKDRQHPDGDCVESFRSKLGTHYLDYAAAYYPWLNTSIVQDSDVSFLNISNIDKLAELLSGEVALMFSDLEGLSEEELSTGGNKLRATRKQAMLDEIAKLSAEISRPDAVLLHKILSNMSPLYQTIMADIKFQQNILPPSSAMAGIYTMVDNSRGVWKAPANVSVNAVVSPTVNISDDEQEDLNVTTQGKSINAIRPFIGEGTLVWGARTLDGNSVDWRYINVRRTMIMLEESIKLASKAYVFEPNVANTWVSMESMLSNFLYGIWKRGGLAGSTPGEAYNVSVGLGKTMTSNDILEGILRITVLVAMVRPAEFIEITFQQKMQES

Source

organism	Salmonella enterica subsp. salamae
ncbi_taxonomy_id	59202
host_organism	Escherichia coli

Entity 2 polymer

description	Phage tail protein
formula_weight	17091.3 kDa
src_method	man
entity_count	18

Polymer

type	polypeptide(L)
strand_id	B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S

MADDGSAQSDTVWPMPKFYFEVKWDGGAGAEMVSAFQEVSGLDSEAQPIEYRAGNSPVFSTIKMPGLIKSGNVTLKKGTFKGDNKFYEWYSKIKMNTIARTAVTINLLDESGAPVMSWKLKNAWPTKVTGTDLKSDSNEVAVETIELAHEGLEISV

Source

organism	Salmonella enterica subsp. salamae
ncbi_taxonomy_id	59202
host_organism	Escherichia coli

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	2.28 Å
resolution_method	—
num_particles	136877

fit	/app/data/saxs_computation/r9/9r9h/9r9h.fit
pddf	/app/data/pr_computation/r9/9r9h/9r9h.pr.out
profile	/app/data/saxs_computation/r9/9r9h/9r9h.dat

;Cryo-EM structure of an extracellular contractile injection system in Salmonella enterica subspecies salamae, the sheath and inner tube module in extended state. ;

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (2)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)