← Back to search

9rlo

PARP15 catalytic domain in complex with OUL250

Method: X-RAY DIFFRACTION D_max: 78.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9rlo
deposition_date	2025-06-17
last_revision	2025-09-17
title	PARP15 catalytic domain in complex with OUL250
keywords	Inhibitor, Complex, ADP-ribosyltransferase, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	23.57 Å
rg_electron	22.43 Å
i0	36472200.00
molecular_weight	45944.0 kDa
excluded_volume	57200 Å³
envelope_volume	68685 Å³
shell_volume	25654 Å³
envelope_diameter	76.2 Å
shell_rg	29.51 Å
envelope_rg	22.54 Å
shape_rg	22.40 Å
total_rg	23.37 Å
total_atoms	6353
n_residues	394
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	78.3 Å
rg_real	23.54 Å
rg_real_error	0.54 Å
i0_real	3.6470e+07
i0_real_error	5.5910e+05
rg_reciprocal	23.55 Å
i0_reciprocal	36470000.0000
total_estimate	0.8781
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	28.1 Å
skewness	0.362
kurtosis	-0.212
angular_range	— – 0.3350 Å⁻¹
current_alpha	0.0000
highest_alpha	8650000.0000
n_real_points	65
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.823; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.947

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Protein mono-ADP-ribosyltransferase PARP15
formula_weight	22967.8 kDa
ec_number	2.4.2.-
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	6595

SMNLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVKKRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSAKDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLFVVFFDNQAYPEYLITFTA

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli BL21

Entity 2 non-polymer

description	4-[[1,4-bis(oxidanylidene)-2,3-dihydrophthalazin-6-yl]oxy]benzamide
formula_weight	297.3 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	DIMETHYL SULFOXIDE
formula_weight	78.1 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	202

▶

6. Citations (1)

▶

length_a	45.400 Å
length_b	68.880 Å
length_c	160.890 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	1.900 Å
resolution_low	43.732 Å
r_factor	—
r_work	0.1817
r_free	0.2204

fit	/app/data/saxs_computation/rl/9rlo/9rlo.fit
pddf	/app/data/pr_computation/rl/9rlo/9rlo.pr.out
profile	/app/data/saxs_computation/rl/9rlo/9rlo.dat

PARP15 catalytic domain in complex with OUL250

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction